Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   AVM03_RS15695 Genome accession   NZ_CP013727
Coordinates   3271180..3271299 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain MBE1283     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3266180..3276299
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AVM03_RS15680 (AVM03_15670) - 3267792..3268475 (+) 684 WP_024084885.1 response regulator transcription factor -
  AVM03_RS15685 (AVM03_15675) - 3268462..3269895 (+) 1434 WP_161625271.1 sensor histidine kinase -
  AVM03_RS15690 (AVM03_15680) rapC 3270048..3271196 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  AVM03_RS15695 (AVM03_15685) phrC 3271180..3271299 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AVM03_RS19780 - 3271449..3271559 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  AVM03_RS15700 (AVM03_15690) - 3271639..3273003 (-) 1365 WP_014304341.1 aspartate kinase -
  AVM03_RS15705 (AVM03_15695) ceuB 3273418..3274371 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  AVM03_RS15710 (AVM03_15700) - 3274361..3275308 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  AVM03_RS15715 (AVM03_15705) - 3275302..3276060 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=142234 AVM03_RS15695 WP_003156334.1 3271180..3271299(+) (phrC) [Bacillus amyloliquefaciens strain MBE1283]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=142234 AVM03_RS15695 WP_003156334.1 3271180..3271299(+) (phrC) [Bacillus amyloliquefaciens strain MBE1283]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment