Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   bslm_RS11840 Genome accession   NZ_CP011101
Coordinates   2397781..2397954 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. LM 4-2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2392781..2402954
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  bslm_RS11825 (BsLM_2413) gcvT 2393580..2394668 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  bslm_RS11830 (BsLM_2414) - 2395110..2396783 (+) 1674 WP_003230203.1 SNF2-related protein -
  bslm_RS11835 (BsLM_2415) - 2396804..2397598 (+) 795 WP_003230200.1 YqhG family protein -
  bslm_RS11840 (BsLM_2416) sinI 2397781..2397954 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  bslm_RS11845 (BsLM_2417) sinR 2397988..2398323 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  bslm_RS11850 (BsLM_2418) tasA 2398416..2399201 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  bslm_RS11855 (BsLM_2419) - 2399265..2399837 (-) 573 WP_003230181.1 signal peptidase I -
  bslm_RS11860 (BsLM_2420) tapA 2399821..2400582 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  bslm_RS11865 (BsLM_2421) - 2400854..2401180 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  bslm_RS11870 (BsLM_2422) - 2401222..2401401 (-) 180 WP_029726723.1 YqzE family protein -
  bslm_RS11875 (BsLM_2423) comGG 2401473..2401847 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  bslm_RS11880 (BsLM_2424) comGF 2401848..2402231 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  bslm_RS11885 (BsLM_2425) comGE 2402257..2402604 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=142192 bslm_RS11840 WP_003230187.1 2397781..2397954(+) (sinI) [Bacillus sp. LM 4-2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=142192 bslm_RS11840 WP_003230187.1 2397781..2397954(+) (sinI) [Bacillus sp. LM 4-2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment