Detailed information    

insolico Bioinformatically predicted

Overview

Name   vraR   Type   Regulator
Locus tag   AU077_RS11780 Genome accession   NZ_CP013688
Coordinates   1903607..1903762 (-) Length   51 a.a.
NCBI ID   WP_223246213.1    Uniprot ID   -
Organism   Streptococcus gallolyticus strain ICDDRB-NRC-S1     
Function   repress expression of competence genes (predicted from homology)   
Competence regulation

Genomic Context

Location: 1898607..1908762
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AU077_RS09575 (AU077_09575) rplB 1898924..1899757 (-) 834 WP_014293737.1 50S ribosomal protein L2 -
  AU077_RS09580 (AU077_09580) - 1899775..1900071 (-) 297 WP_014293736.1 50S ribosomal protein L23 -
  AU077_RS09585 (AU077_09585) rplD 1900071..1900694 (-) 624 WP_058621977.1 50S ribosomal protein L4 -
  AU077_RS09590 (AU077_09590) rplC 1900718..1901344 (-) 627 WP_006531320.1 50S ribosomal protein L3 -
  AU077_RS09595 (AU077_09595) rpsJ 1901422..1901730 (-) 309 WP_014293735.1 30S ribosomal protein S10 -
  AU077_RS11765 - 1902312..1902518 (-) 207 WP_223246212.1 hypothetical protein -
  AU077_RS11770 - 1902640..1902966 (-) 327 WP_257235393.1 LysR family transcriptional regulator substrate-binding protein -
  AU077_RS12010 - 1902979..1903107 (-) 129 WP_257235392.1 hypothetical protein -
  AU077_RS12015 - 1903123..1903257 (-) 135 WP_257235391.1 hypothetical protein -
  AU077_RS11775 - 1903384..1903533 (-) 150 WP_223246211.1 LysR family transcriptional regulator -
  AU077_RS11780 vraR 1903607..1903762 (-) 156 WP_223246213.1 response regulator transcription factor Regulator
  AU077_RS09610 (AU077_09610) - 1903772..1904230 (-) 459 WP_223246210.1 response regulator -
  AU077_RS09615 (AU077_09615) - 1904315..1905202 (-) 888 WP_230937544.1 histidine kinase -
  AU077_RS09620 (AU077_09620) - 1905420..1907180 (-) 1761 WP_230937545.1 MMPL family transporter -
  AU077_RS11785 - 1907147..1907449 (-) 303 WP_229025069.1 hypothetical protein -

Sequence

Protein


Download         Length: 51 a.a.        Molecular weight: 5868.75 Da        Isoelectric Point: 7.0040

>NTDB_id=142004 AU077_RS11780 WP_223246213.1 1903607..1903762(-) (vraR) [Streptococcus gallolyticus strain ICDDRB-NRC-S1]
MVAEGLTNKEIAAQLFVTDRTVKNYLTELYEIFQVNNRAQAIAYAIRHNLI

Nucleotide


Download         Length: 156 bp        

>NTDB_id=142004 AU077_RS11780 WP_223246213.1 1903607..1903762(-) (vraR) [Streptococcus gallolyticus strain ICDDRB-NRC-S1]
GTGGTAGCTGAGGGATTGACCAATAAAGAAATTGCAGCTCAGCTATTTGTTACTGACCGCACGGTAAAAAACTATCTAAC
GGAACTTTATGAGATTTTTCAAGTCAATAATCGAGCTCAAGCAATTGCTTACGCGATAAGACACAACCTAATTTGA

Domains

Predicted by InterProScan.

Bacterial regulatory proteins, luxR family (GerE)

(1-45)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  vraR Staphylococcus aureus N315

39.216

100

0.392

Multiple sequence alignment