Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | VU19_RS04860 | Genome accession | NZ_CP011068 |
| Coordinates | 985870..986058 (-) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain STAB10015 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 978286..1032812 | 985870..986058 | within | 0 |
Gene organization within MGE regions
Location: 978286..1032812
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VU19_RS04830 (VU19_04825) | pfkA | 978286..979299 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| VU19_RS04835 (VU19_04830) | - | 979379..982489 (-) | 3111 | WP_011284836.1 | DNA polymerase III subunit alpha | - |
| VU19_RS04840 (VU19_04835) | - | 982674..983045 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| VU19_RS04845 (VU19_04840) | - | 983045..983743 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| VU19_RS04850 (VU19_04845) | - | 983753..984538 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| VU19_RS04855 (VU19_04850) | - | 984665..985279 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| VU19_RS04860 (VU19_04855) | prx | 985870..986058 (-) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| VU19_RS04865 (VU19_04860) | mf2 | 986298..987056 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| VU19_RS04870 (VU19_04865) | speC | 987167..987874 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| VU19_RS04875 (VU19_04870) | - | 987950..989284 (-) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| VU19_RS04885 (VU19_04880) | - | 989396..989581 (-) | 186 | WP_011284839.1 | holin | - |
| VU19_RS04890 (VU19_04885) | - | 989578..989874 (-) | 297 | WP_002990012.1 | hypothetical protein | - |
| VU19_RS04895 (VU19_04890) | - | 989885..990502 (-) | 618 | WP_011284840.1 | hypothetical protein | - |
| VU19_RS10430 | - | 990505..990666 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| VU19_RS04900 (VU19_04895) | - | 990680..992575 (-) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| VU19_RS04905 (VU19_04900) | - | 992586..992900 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| VU19_RS04910 (VU19_04905) | - | 992902..994116 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| VU19_RS04915 (VU19_04910) | - | 994113..996167 (-) | 2055 | WP_047716000.1 | phage tail spike protein | - |
| VU19_RS04920 (VU19_04915) | - | 996164..996943 (-) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| VU19_RS04925 (VU19_04920) | - | 996975..1000610 (-) | 3636 | WP_011284846.1 | tape measure protein | - |
| VU19_RS04930 (VU19_04925) | - | 1000625..1000921 (-) | 297 | WP_021340179.1 | hypothetical protein | - |
| VU19_RS04935 (VU19_04930) | - | 1000996..1001349 (-) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| VU19_RS04940 (VU19_04935) | - | 1001403..1002026 (-) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| VU19_RS04945 (VU19_04940) | - | 1002081..1002470 (-) | 390 | WP_011284850.1 | hypothetical protein | - |
| VU19_RS04950 (VU19_04945) | - | 1002467..1002832 (-) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| VU19_RS04955 (VU19_04950) | - | 1002813..1003121 (-) | 309 | WP_011284852.1 | hypothetical protein | - |
| VU19_RS04960 (VU19_04955) | - | 1003118..1003471 (-) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| VU19_RS04965 (VU19_04960) | - | 1003485..1003727 (-) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| VU19_RS04970 (VU19_04965) | - | 1003737..1004819 (-) | 1083 | WP_011284855.1 | major capsid protein | - |
| VU19_RS04975 (VU19_04970) | - | 1004822..1005202 (-) | 381 | WP_011284856.1 | head decoration protein | - |
| VU19_RS04980 (VU19_04975) | - | 1005212..1005745 (-) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| VU19_RS04985 (VU19_04980) | - | 1005889..1006155 (-) | 267 | WP_011284858.1 | hypothetical protein | - |
| VU19_RS04990 (VU19_04985) | - | 1006158..1006472 (-) | 315 | WP_011284859.1 | hypothetical protein | - |
| VU19_RS04995 (VU19_04990) | - | 1006542..1006727 (-) | 186 | WP_002988389.1 | hypothetical protein | - |
| VU19_RS05000 (VU19_04995) | - | 1006731..1008293 (-) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| VU19_RS05005 (VU19_05000) | - | 1008274..1009776 (-) | 1503 | WP_002984369.1 | phage portal protein | - |
| VU19_RS05010 (VU19_05005) | - | 1009788..1011095 (-) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| VU19_RS05015 (VU19_05010) | - | 1011073..1011504 (-) | 432 | WP_023079766.1 | terminase small subunit | - |
| VU19_RS05020 (VU19_05015) | - | 1011603..1011788 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| VU19_RS05025 (VU19_05020) | - | 1011840..1012217 (+) | 378 | WP_047716001.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| VU19_RS10375 (VU19_05025) | - | 1012512..1012745 (+) | 234 | WP_002995461.1 | hypothetical protein | - |
| VU19_RS05035 (VU19_05030) | - | 1012835..1013749 (-) | 915 | WP_011284864.1 | hypothetical protein | - |
| VU19_RS05040 (VU19_05035) | - | 1014327..1014761 (-) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| VU19_RS10435 | - | 1015043..1015213 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| VU19_RS05045 (VU19_05040) | - | 1015210..1015689 (-) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| VU19_RS05050 (VU19_05045) | - | 1015694..1016326 (-) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| VU19_RS05055 (VU19_05050) | - | 1016328..1016612 (-) | 285 | WP_011284869.1 | hypothetical protein | - |
| VU19_RS10440 | - | 1016609..1016779 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| VU19_RS05060 (VU19_05055) | - | 1016776..1017012 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| VU19_RS10720 (VU19_05060) | - | 1017012..1017257 (-) | 246 | WP_011284872.1 | hypothetical protein | - |
| VU19_RS05070 (VU19_05065) | - | 1017254..1017610 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| VU19_RS05075 (VU19_05070) | - | 1017594..1017878 (-) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| VU19_RS05080 (VU19_05075) | - | 1017898..1018767 (-) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| VU19_RS05085 (VU19_05080) | - | 1019036..1020589 (-) | 1554 | WP_011284875.1 | hypothetical protein | - |
| VU19_RS05090 (VU19_05085) | - | 1020607..1021089 (-) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| VU19_RS05095 (VU19_05090) | - | 1021094..1022527 (-) | 1434 | Protein_969 | DEAD/DEAH box helicase | - |
| VU19_RS05100 (VU19_05095) | - | 1022533..1023216 (-) | 684 | WP_002984321.1 | AAA family ATPase | - |
| VU19_RS05105 (VU19_05100) | - | 1023213..1023497 (-) | 285 | WP_011284877.1 | hypothetical protein | - |
| VU19_RS05110 (VU19_05105) | - | 1023494..1023688 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| VU19_RS05115 (VU19_05110) | - | 1023688..1024017 (-) | 330 | WP_011284878.1 | hypothetical protein | - |
| VU19_RS10445 | - | 1024098..1024235 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| VU19_RS05120 (VU19_05115) | - | 1024232..1024528 (-) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| VU19_RS05125 (VU19_05120) | - | 1024607..1024792 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| VU19_RS05130 (VU19_05125) | - | 1024959..1025198 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| VU19_RS05135 (VU19_05130) | - | 1025348..1025557 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| VU19_RS05145 (VU19_05140) | - | 1025816..1026325 (+) | 510 | WP_011017884.1 | hypothetical protein | - |
| VU19_RS05150 (VU19_05145) | - | 1026433..1026660 (-) | 228 | WP_002984281.1 | hypothetical protein | - |
| VU19_RS05155 (VU19_05150) | - | 1026734..1027120 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| VU19_RS05160 (VU19_05155) | - | 1027109..1027318 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| VU19_RS05165 (VU19_05160) | - | 1027372..1027971 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| VU19_RS10450 | - | 1028001..1028159 (-) | 159 | WP_011284883.1 | hypothetical protein | - |
| VU19_RS05170 (VU19_05165) | - | 1028218..1028433 (+) | 216 | WP_021341080.1 | hypothetical protein | - |
| VU19_RS10455 | - | 1028419..1028568 (-) | 150 | WP_021340643.1 | hypothetical protein | - |
| VU19_RS05175 (VU19_05170) | - | 1028926..1029669 (+) | 744 | WP_011284884.1 | XRE family transcriptional regulator | - |
| VU19_RS05180 (VU19_05175) | - | 1029682..1030491 (+) | 810 | WP_023079768.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| VU19_RS05185 (VU19_05180) | - | 1030741..1031829 (+) | 1089 | WP_023079773.1 | site-specific integrase | - |
| VU19_RS05190 (VU19_05185) | - | 1032192..1032812 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=141933 VU19_RS04860 WP_002993136.1 985870..986058(-) (prx) [Streptococcus pyogenes strain STAB10015]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=141933 VU19_RS04860 WP_002993136.1 985870..986058(-) (prx) [Streptococcus pyogenes strain STAB10015]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |