Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   AUQ45_RS10105 Genome accession   NZ_CP013672
Coordinates   390259..390477 (+) Length   72 a.a.
NCBI ID   WP_011528334.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain AP53     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 385259..395477
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AUQ45_RS02020 (AUQ45_0370) - 386268..386843 (+) 576 WP_011284574.1 uracil-DNA glycosylase family protein -
  AUQ45_RS02025 (AUQ45_0371) ybeY 387002..387499 (+) 498 WP_002985748.1 rRNA maturation RNase YbeY -
  AUQ45_RS02030 (AUQ45_0372) - 387480..387887 (+) 408 WP_002985746.1 diacylglycerol kinase family protein -
  AUQ45_RS02035 (AUQ45_0373) era 388007..388903 (+) 897 WP_014635331.1 GTPase Era -
  AUQ45_RS02040 (AUQ45_0374) - 388923..389399 (+) 477 WP_014635332.1 NUDIX hydrolase -
  AUQ45_RS10100 (AUQ45_0375) - 389704..389958 (-) 255 WP_010921971.1 hypothetical protein -
  AUQ45_RS10105 comE/blpR 390259..390477 (+) 219 WP_011528334.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  AUQ45_RS10110 - 390674..392280 (-) 1607 Protein_359 ABC transporter transmembrane domain-containing protein -
  AUQ45_RS02060 (AUQ45_0379) - 392578..392802 (+) 225 WP_002994580.1 Blp family class II bacteriocin -
  AUQ45_RS09925 (AUQ45_0380) - 392780..392956 (+) 177 WP_002994581.1 hypothetical protein -
  AUQ45_RS10360 - 393251..393562 (+) 312 WP_225793061.1 CPBP family intramembrane glutamic endopeptidase -
  AUQ45_RS10250 (AUQ45_0381) - 393647..393775 (+) 129 WP_002994583.1 hypothetical protein -
  AUQ45_RS02070 (AUQ45_0382) - 394173..394400 (+) 228 WP_028797129.1 Blp family class II bacteriocin -
  AUQ45_RS02075 (AUQ45_0383) - 394449..394766 (+) 318 WP_002994587.1 hypothetical protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8680.16 Da        Isoelectric Point: 10.5045

>NTDB_id=141899 AUQ45_RS10105 WP_011528334.1 390259..390477(+) (comE/blpR) [Streptococcus pyogenes strain AP53]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKIYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=141899 AUQ45_RS10105 WP_011528334.1 390259..390477(+) (comE/blpR) [Streptococcus pyogenes strain AP53]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGATTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(3-56)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417