Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   BIS30_RS18940 Genome accession   NZ_CP011051
Coordinates   3620483..3621262 (+) Length   259 a.a.
NCBI ID   WP_003220850.1    Uniprot ID   G4NSM6
Organism   Bacillus spizizenii strain T30     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3594972..3635956 3620483..3621262 within 0


Gene organization within MGE regions


Location: 3594972..3635956
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BIS30_RS18815 (BIS30_18815) smc 3595673..3599233 (+) 3561 WP_003221570.1 chromosome segregation protein SMC -
  BIS30_RS18820 (BIS30_18820) ftsY 3599253..3600242 (+) 990 WP_003221572.1 signal recognition particle-docking protein FtsY -
  BIS30_RS18830 (BIS30_18830) - 3600377..3601476 (+) 1100 WP_230939496.1 IS3 family transposase -
  BIS30_RS18835 (BIS30_18835) - 3601540..3602025 (-) 486 WP_003220807.1 Ig-like domain-containing protein -
  BIS30_RS18840 (BIS30_18840) - 3602204..3602536 (+) 333 WP_003220809.1 putative DNA-binding protein -
  BIS30_RS18845 (BIS30_18845) ffh 3602550..3603890 (+) 1341 WP_003220811.1 signal recognition particle protein -
  BIS30_RS18850 (BIS30_18850) rpsP 3603996..3604268 (+) 273 WP_003220815.1 30S ribosomal protein S16 -
  BIS30_RS18855 (BIS30_18855) - 3604268..3604513 (+) 246 WP_003220817.1 KH domain-containing protein -
  BIS30_RS18860 (BIS30_18860) - 3604635..3605021 (+) 387 WP_003220819.1 YlqD family protein -
  BIS30_RS18865 (BIS30_18865) rimM 3605026..3605550 (+) 525 WP_003220821.1 ribosome maturation factor RimM -
  BIS30_RS18870 (BIS30_18870) trmD 3605547..3606278 (+) 732 WP_003220823.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  BIS30_RS18875 (BIS30_18875) rplS 3606418..3606765 (+) 348 WP_003220825.1 50S ribosomal protein L19 -
  BIS30_RS18880 (BIS30_18880) ylqF 3606910..3607758 (+) 849 WP_003220827.1 ribosome biogenesis GTPase YlqF -
  BIS30_RS18885 (BIS30_18885) rnhB 3607829..3608596 (+) 768 WP_003220829.1 ribonuclease HII -
  BIS30_RS18890 (BIS30_18890) - 3608625..3610355 (+) 1731 WP_003220832.1 hypothetical protein -
  BIS30_RS18895 (BIS30_18895) - 3610352..3610633 (+) 282 WP_003220834.1 FlhB-like flagellar biosynthesis protein -
  BIS30_RS18900 (BIS30_18900) sucC 3610807..3611964 (+) 1158 WP_003220835.1 ADP-forming succinate--CoA ligase subunit beta -
  BIS30_RS18905 (BIS30_18905) sucD 3611993..3612895 (+) 903 WP_003220837.1 succinate--CoA ligase subunit alpha -
  BIS30_RS18910 (BIS30_18910) dprA 3612956..3613849 (+) 894 WP_003220839.1 DNA-processing protein DprA Machinery gene
  BIS30_RS18915 (BIS30_18915) topA 3614036..3616111 (+) 2076 WP_003220843.1 type I DNA topoisomerase -
  BIS30_RS18920 (BIS30_18920) trmFO 3616187..3617494 (+) 1308 WP_003220844.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  BIS30_RS18925 (BIS30_18925) xerC 3617562..3618476 (+) 915 WP_003220846.1 tyrosine recombinase XerC -
  BIS30_RS18930 (BIS30_18930) clpQ 3618489..3619034 (+) 546 WP_003220848.1 ATP-dependent protease subunit ClpQ -
  BIS30_RS18935 (BIS30_18935) hslU 3619051..3620443 (+) 1393 Protein_3672 HslU--HslV peptidase ATPase subunit -
  BIS30_RS18940 (BIS30_18940) codY 3620483..3621262 (+) 780 WP_003220850.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  BIS30_RS18945 (BIS30_18945) flgB 3621643..3622032 (+) 390 WP_003220852.1 flagellar basal body rod protein FlgB -
  BIS30_RS18950 (BIS30_18950) flgC 3622032..3622484 (+) 453 WP_003220854.1 flagellar basal body rod protein FlgC -
  BIS30_RS18955 (BIS30_18955) fliE 3622496..3622816 (+) 321 WP_003238544.1 flagellar hook-basal body complex protein FliE -
  BIS30_RS18960 (BIS30_18960) fliF 3622862..3624472 (+) 1611 WP_079996358.1 flagellar basal-body MS-ring/collar protein FliF -
  BIS30_RS18965 (BIS30_18965) fliG 3624485..3625501 (+) 1017 WP_003220860.1 flagellar motor switch protein FliG -
  BIS30_RS18970 (BIS30_18970) fliH 3625494..3626246 (+) 753 WP_003220862.1 flagellar assembly protein FliH -
  BIS30_RS18975 (BIS30_18975) fliI 3626243..3627559 (+) 1317 WP_003220864.1 flagellar protein export ATPase FliI -
  BIS30_RS18980 (BIS30_18980) fliJ 3627562..3628005 (+) 444 WP_003220866.1 flagellar export protein FliJ -
  BIS30_RS18985 (BIS30_18985) - 3628017..3628631 (+) 615 WP_003220869.1 MotE family protein -
  BIS30_RS18990 (BIS30_18990) - 3628643..3630106 (+) 1464 WP_003220871.1 flagellar hook-length control protein FliK -
  BIS30_RS18995 (BIS30_18995) flgD 3630103..3630525 (+) 423 WP_003220873.1 flagellar hook assembly protein FlgD -
  BIS30_RS19000 (BIS30_19000) flgG 3630547..3631341 (+) 795 WP_003220874.1 flagellar basal body rod protein FlgG -
  BIS30_RS19005 (BIS30_19005) swrD 3631381..3631596 (+) 216 WP_003220876.1 swarming motility protein SwrD -
  BIS30_RS19010 (BIS30_19010) fliL 3631593..3632018 (+) 426 WP_003220878.1 flagellar basal body-associated protein FliL -
  BIS30_RS19015 (BIS30_19015) fliM 3632052..3633050 (+) 999 WP_003220879.1 flagellar motor switch protein FliM -
  BIS30_RS19020 (BIS30_19020) fliY 3633040..3634179 (+) 1140 WP_003220881.1 flagellar motor switch phosphatase FliY -
  BIS30_RS19025 (BIS30_19025) cheY 3634205..3634567 (+) 363 WP_003220882.1 chemotaxis protein CheY -
  BIS30_RS19030 (BIS30_19030) fliZ 3634582..3635241 (+) 660 WP_003220884.1 flagella biosynthesis regulatory protein FliZ -
  BIS30_RS19035 (BIS30_19035) fliP 3635234..3635899 (+) 666 WP_003220886.1 flagellar type III secretion system pore protein FliP -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 29013.22 Da        Isoelectric Point: 4.6514

>NTDB_id=141820 BIS30_RS18940 WP_003220850.1 3620483..3621262(+) (codY) [Bacillus spizizenii strain T30]
MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLF
NVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNNKFLIELENLKSH

Nucleotide


Download         Length: 780 bp        

>NTDB_id=141820 BIS30_RS18940 WP_003220850.1 3620483..3621262(+) (codY) [Bacillus spizizenii strain T30]
ATGGCTTTATTACAAAAAACACGAATTATTAACTCCATGCTGCAAGCTGCGGCAGGGAAACCGGTAAACTTCAAGGAAAT
GGCGGAGACGCTGCGGGATGTAATTGATTCCAATATTTTCGTTGTAAGCCGCAGAGGCAAACTCCTTGGATATTCTATTA
ACCAGCAAATTGAAAATGATCGTATGAAAAAAATGCTTGAGGATCGTCAATTCCCTGAAGAATATACGAAAAATCTATTT
AACGTCCCTGAAACATCTTCTAACTTGGACATTAATAGTGAATATACTGCTTTTCCTGTTGAGAACAGAGACTTGTTTCA
AGCTGGTTTAACAACAATTGTACCGATCATCGGAGGCGGAGAAAGATTAGGAACACTCATTCTTTCACGTTTACAGGATC
AATTTAATGACGATGACTTAATTCTCGCTGAATACGGCGCTACAGTTGTCGGTATGGAGATCCTGAGAGAAAAAGCAGAA
GAAATCGAAGAGGAAGCAAGAAGCAAAGCTGTCGTTCAAATGGCTATCAGTTCTCTTTCTTACAGTGAGCTTGAAGCAAT
TGAGCACATTTTTGAAGAGCTTGACGGAAACGAAGGTCTTCTCGTTGCAAGTAAAATCGCTGACCGCGTCGGGATTACCC
GTTCTGTTATTGTGAATGCACTCAGAAAGCTGGAAAGCGCGGGTGTTATCGAGTCAAGATCATTAGGAATGAAAGGTACT
TATATCAAAGTCCTAAACAATAAATTCCTAATCGAATTAGAAAATCTAAAATCTCATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NSM6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

100

100

1

  codY Lactococcus lactis subsp. lactis strain DGCC12653

47.451

98.456

0.467


Multiple sequence alignment