Detailed information    

insolico Bioinformatically predicted

Overview


Name   sepM   Type   Regulator
Locus tag   MNA02_RS07815 Genome accession   NZ_CP010999
Coordinates   1498053..1499129 (-) Length   358 a.a.
NCBI ID   WP_011681549.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain MN-BM-A02     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1483306..1556103 1498053..1499129 within 0


Gene organization within MGE regions


Location: 1483306..1556103
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MNA02_RS07750 (MNA02_1592) - 1484197..1484748 (-) 552 WP_002946999.1 cysteine hydrolase family protein -
  MNA02_RS07755 (MNA02_1593) codY 1484811..1485596 (-) 786 WP_002951720.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  MNA02_RS07760 (MNA02_1594) - 1485856..1487070 (-) 1215 WP_002951721.1 pyridoxal phosphate-dependent aminotransferase -
  MNA02_RS07765 (MNA02_1595) - 1487425..1487877 (+) 453 WP_002946987.1 universal stress protein -
  MNA02_RS10485 - 1488057..1488628 (+) 572 Protein_1473 IS30 family transposase -
  MNA02_RS11310 (MNA02_1597) - 1488700..1488873 (-) 174 WP_011681546.1 hypothetical protein -
  MNA02_RS07775 (MNA02_1598) - 1488934..1489308 (-) 375 WP_011681547.1 membrane protein -
  MNA02_RS07780 (MNA02_1599) pflA 1489520..1490320 (-) 801 WP_002946980.1 pyruvate formate-lyase-activating protein -
  MNA02_RS10975 - 1490508..1490618 (-) 111 WP_014621906.1 LPXTG cell wall anchor domain-containing protein -
  MNA02_RS07785 (MNA02_1600) - 1491316..1492647 (-) 1332 WP_024703987.1 hemolysin family protein -
  MNA02_RS07790 (MNA02_1601) - 1492761..1493543 (+) 783 WP_024703988.1 ABC transporter ATP-binding protein -
  MNA02_RS07795 (MNA02_1602) - 1494165..1496231 (-) 2067 WP_011681548.1 cation:proton antiporter -
  MNA02_RS07800 (MNA02_1603) - 1496240..1496482 (-) 243 WP_011226461.1 hypothetical protein -
  MNA02_RS07805 (MNA02_1604) - 1496479..1497027 (-) 549 WP_011226462.1 tRNA (mnm(5)s(2)U34)-methyltransferase -
  MNA02_RS07810 (MNA02_1605) - 1497024..1497968 (-) 945 WP_011226463.1 TIGR01212 family radical SAM protein -
  MNA02_RS07815 (MNA02_1606) sepM 1498053..1499129 (-) 1077 WP_011681549.1 SepM family pheromone-processing serine protease Regulator
  MNA02_RS07820 (MNA02_1607) coaD 1499107..1499604 (-) 498 WP_011681550.1 pantetheine-phosphate adenylyltransferase -
  MNA02_RS07825 (MNA02_1608) rsmD 1499638..1500237 (-) 600 Protein_1486 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  MNA02_RS07830 (MNA02_1609) trxB 1500328..1501281 (-) 954 WP_255136104.1 thioredoxin-disulfide reductase -
  MNA02_RS07835 (MNA02_1610) - 1501314..1501538 (-) 225 WP_014621911.1 DUF4059 family protein -
  MNA02_RS07840 (MNA02_1611) - 1501753..1502496 (-) 744 WP_014608652.1 amino acid ABC transporter ATP-binding protein -
  MNA02_RS07845 (MNA02_1612) - 1502496..1503242 (-) 747 WP_100284797.1 amino acid ABC transporter permease -
  MNA02_RS07850 (MNA02_1613) - 1503630..1504460 (-) 831 WP_014608653.1 transporter substrate-binding domain-containing protein -
  MNA02_RS07855 (MNA02_1614) - 1504920..1505153 (-) 234 WP_002947030.1 hypothetical protein -
  MNA02_RS07860 (MNA02_1615) dinB 1505451..1506554 (-) 1104 WP_014608654.1 DNA polymerase IV -
  MNA02_RS07865 (MNA02_1616) pflB 1506833..1509142 (+) 2310 WP_011226473.1 formate C-acetyltransferase -
  MNA02_RS07870 (MNA02_1617) - 1509409..1510191 (+) 783 WP_011681555.1 carbonic anhydrase -
  MNA02_RS07875 (MNA02_1618) - 1510242..1510694 (+) 453 WP_014608655.1 GNAT family N-acetyltransferase -
  MNA02_RS07880 (MNA02_1619) - 1511045..1511350 (-) 306 WP_014621914.1 restriction endonuclease subunit S -
  MNA02_RS12040 (MNA02_1620) mobV 1511375..1511883 (-) 509 Protein_1498 MobV family relaxase -
  MNA02_RS07895 (MNA02_1621) - 1512328..1513083 (-) 756 WP_011681558.1 ABC transporter permease -
  MNA02_RS07900 (MNA02_1622) - 1513080..1513730 (-) 651 WP_024703990.1 ATP-binding cassette domain-containing protein -
  MNA02_RS07905 (MNA02_1624) - 1513933..1514889 (-) 957 WP_024703991.1 serine hydrolase domain-containing protein -
  MNA02_RS07910 (MNA02_1625) - 1514889..1515644 (-) 756 WP_011681560.1 CppA family protein -
  MNA02_RS07915 (MNA02_1626) - 1515926..1516288 (+) 363 WP_014608659.1 CPBP family intramembrane glutamic endopeptidase -
  MNA02_RS07920 (MNA02_1627) gla 1516375..1517238 (-) 864 WP_002951781.1 aquaglyceroporin Gla -
  MNA02_RS07925 (MNA02_1628) - 1517359..1519626 (+) 2268 WP_011681561.1 Xaa-Pro dipeptidyl-peptidase -
  MNA02_RS07930 - 1519706..1520086 (-) 381 WP_002951783.1 hypothetical protein -
  MNA02_RS10870 - 1520211..1520474 (-) 264 WP_002945924.1 hypothetical protein -
  MNA02_RS07935 (MNA02_1630) - 1520796..1521092 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  MNA02_RS07940 (MNA02_1631) - 1521257..1521463 (-) 207 WP_011681562.1 hypothetical protein -
  MNA02_RS07945 (MNA02_1632) - 1521494..1522186 (-) 693 WP_224103184.1 thioredoxin family protein -
  MNA02_RS10505 - 1522377..1523947 (+) 1571 WP_106693466.1 IS3-like element ISSth1b family transposase -
  MNA02_RS07960 (MNA02_1635) - 1524093..1524347 (-) 255 WP_014608660.1 Blp family class II bacteriocin -
  MNA02_RS12045 - 1524598..1524999 (-) 402 WP_024703992.1 hypothetical protein -
  MNA02_RS07980 (MNA02_1637) - 1526004..1526234 (-) 231 WP_014608662.1 bacteriocin class II family protein -
  MNA02_RS07985 (MNA02_1638) - 1526590..1526790 (-) 201 WP_011681569.1 hypothetical protein -
  MNA02_RS07990 (MNA02_1639) - 1526809..1526985 (-) 177 WP_011681570.1 Blp family class II bacteriocin -
  MNA02_RS07995 (MNA02_1640) - 1527239..1527970 (+) 732 WP_002948869.1 LytR/AlgR family response regulator transcription factor -
  MNA02_RS11765 - 1528507..1529310 (+) 804 WP_224107502.1 ATP-binding protein -
  MNA02_RS08005 (MNA02_1642) - 1529328..1529489 (-) 162 WP_011681573.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  MNA02_RS08010 (MNA02_1643) - 1529504..1530871 (-) 1368 WP_011681574.1 bacteriocin secretion accessory protein -
  MNA02_RS08015 (MNA02_1645) - 1530887..1533039 (-) 2153 Protein_1521 peptide cleavage/export ABC transporter -
  MNA02_RS08020 (MNA02_1647) - 1534053..1535798 (-) 1746 WP_024703994.1 ABC transporter ATP-binding protein -
  MNA02_RS08025 (MNA02_1648) - 1535791..1537548 (-) 1758 WP_024703995.1 ABC transporter ATP-binding protein -
  MNA02_RS11770 (MNA02_1649) - 1537736..1537942 (-) 207 WP_002948879.1 hypothetical protein -
  MNA02_RS08035 (MNA02_1650) - 1538147..1538674 (-) 528 WP_011226503.1 VanZ family protein -
  MNA02_RS08040 (MNA02_1651) rlmN 1538676..1539845 (-) 1170 WP_011226504.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  MNA02_RS08045 (MNA02_1652) - 1539849..1540571 (-) 723 WP_024703996.1 YutD family protein -
  MNA02_RS08050 (MNA02_1653) - 1540626..1541981 (-) 1356 WP_002948886.1 bifunctional metallophosphatase/5'-nucleotidase -
  MNA02_RS08055 (MNA02_1655) - 1542829..1544172 (-) 1344 WP_014608670.1 DEAD/DEAH box helicase -
  MNA02_RS08060 (MNA02_1656) mraY 1544247..1545269 (-) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  MNA02_RS08065 (MNA02_1657) pbp2X 1545271..1547538 (-) 2268 WP_011681584.1 penicillin-binding protein PBP2X -
  MNA02_RS08070 (MNA02_1658) ftsL 1547542..1547862 (-) 321 WP_002948801.1 cell division protein FtsL -
  MNA02_RS08075 (MNA02_1659) rsmH 1547865..1548815 (-) 951 WP_014621931.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  MNA02_RS11775 (MNA02_1660) - 1548981..1549409 (-) 429 WP_011681585.1 hypothetical protein -
  MNA02_RS11780 (MNA02_1661) - 1549375..1549590 (-) 216 WP_011681586.1 hypothetical protein -
  MNA02_RS11785 (MNA02_1662) - 1549587..1549973 (-) 387 WP_011681587.1 hypothetical protein -
  MNA02_RS10885 - 1550041..1550304 (+) 264 WP_164926319.1 hypothetical protein -
  MNA02_RS08100 (MNA02_1665) - 1550610..1550966 (-) 357 WP_014621938.1 DUF805 domain-containing protein -
  MNA02_RS08105 (MNA02_1666) - 1551186..1551476 (-) 291 WP_014621939.1 hypothetical protein -
  MNA02_RS08110 (MNA02_1667) - 1551810..1553060 (-) 1251 WP_014621940.1 glutamate-5-semialdehyde dehydrogenase -
  MNA02_RS08115 (MNA02_1668) proB 1553062..1553865 (-) 804 WP_014621941.1 glutamate 5-kinase -
  MNA02_RS08120 (MNA02_1669) - 1553986..1555575 (-) 1590 WP_014608677.1 ABC transporter permease -

Sequence


Protein


Download         Length: 358 a.a.        Molecular weight: 39172.02 Da        Isoelectric Point: 9.3888

>NTDB_id=141240 MNA02_RS07815 WP_011681549.1 1498053..1499129(-) (sepM) [Streptococcus thermophilus strain MN-BM-A02]
MANKTKSKALLEKMWRIKWWLLSIFTVLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYAQFNDFAKLQTAEEATGNYSDEDFMRINQFYMETSQNQAVYQGLTLAGKEVSLEYMGVYVLQVADDSSFKGVLN
IADTVTAVNGNTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLMFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGAVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKADPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=141240 MNA02_RS07815 WP_011681549.1 1498053..1499129(-) (sepM) [Streptococcus thermophilus strain MN-BM-A02]
GTGGCAAACAAGACAAAATCTAAAGCGCTATTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGGT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCGCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATGCTCAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATGCGCATCAACCAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGGAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTGTCCTCAAT
ATTGCTGATACGGTGACGGCTGTTAATGGTAATACCTTTGATAATTCTACTGACATGATTAAATACGTTCAAGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGCAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAGATCAAGAGTCCTGAGAATGTTAAGTTTAAACTGGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATGTTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGGCTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGCTGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGGACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains


Predicted by InterproScan.

(137-206)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

62.757

95.251

0.598


Multiple sequence alignment