Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   SB45_RS14345 Genome accession   NZ_CP010556
Coordinates   2999508..2999648 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain L-H15     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2994508..3004648
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SB45_RS14320 (SB45_14320) - 2994805..2995188 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  SB45_RS14325 (SB45_14325) comA 2995210..2995854 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  SB45_RS14330 (SB45_14330) comP 2995935..2998238 (-) 2304 WP_003152050.1 histidine kinase Regulator
  SB45_RS14335 (SB45_14335) comX 2998258..2998437 (-) 180 WP_306383677.1 competence pheromone ComX -
  SB45_RS14340 (SB45_14340) comQ 2998391..2999377 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  SB45_RS14345 (SB45_14345) degQ 2999508..2999648 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  SB45_RS14350 (SB45_14350) - 3000114..3000455 (+) 342 WP_014305721.1 hypothetical protein -
  SB45_RS14355 (SB45_14355) - 3000462..3001682 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  SB45_RS14360 (SB45_14360) - 3001812..3003278 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  SB45_RS14365 (SB45_14365) - 3003296..3003847 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  SB45_RS14370 (SB45_14370) - 3003944..3004342 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=139284 SB45_RS14345 WP_003152043.1 2999508..2999648(-) (degQ) [Bacillus velezensis strain L-H15]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=139284 SB45_RS14345 WP_003152043.1 2999508..2999648(-) (degQ) [Bacillus velezensis strain L-H15]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment