Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   RP72_RS06195 Genome accession   NZ_CP010314
Coordinates   1187086..1187277 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1182086..1192277
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RP72_RS06165 (RP72_06165) argF 1182950..1183909 (+) 960 WP_003232980.1 ornithine carbamoyltransferase -
  RP72_RS06170 (RP72_06170) yjzC 1183995..1184174 (+) 180 WP_003245356.1 YjzC family protein -
  RP72_RS06175 (RP72_06175) yjzD 1184220..1184405 (-) 186 WP_003245236.1 DUF2929 domain-containing protein -
  RP72_RS06180 (RP72_06180) - 1184654..1185388 (+) 735 WP_003245223.1 hypothetical protein -
  RP72_RS06185 (RP72_06185) - 1185470..1186027 (+) 558 WP_003232974.1 hypothetical protein -
  RP72_RS06190 (RP72_06190) med 1186118..1187071 (+) 954 WP_003245494.1 transcriptional regulator Med Regulator
  RP72_RS06195 (RP72_06195) comZ 1187086..1187277 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  RP72_RS06200 (RP72_06200) yjzB 1187307..1187546 (-) 240 WP_003232972.1 spore coat protein YjzB -
  RP72_RS06205 (RP72_06205) fabH 1187711..1188649 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  RP72_RS06210 (RP72_06210) fabF 1188672..1189913 (+) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  RP72_RS06215 (RP72_06215) yjaZ 1189989..1190774 (+) 786 WP_003232967.1 DUF2268 domain-containing protein -
  RP72_RS06220 (RP72_06220) appD 1190966..1191952 (+) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=136259 RP72_RS06195 WP_003224559.1 1187086..1187277(+) (comZ) [Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=136259 RP72_RS06195 WP_003224559.1 1187086..1187277(+) (comZ) [Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterProScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment