Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   NF53_RS12075 Genome accession   NZ_CP010106
Coordinates   2317810..2318091 (+) Length   93 a.a.
NCBI ID   WP_000843025.1    Uniprot ID   A0AAN4KMT0
Organism   Bacillus thuringiensis serovar indiana strain HD521     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Genomic Context


Location: 2312810..2323091
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NF53_RS12025 (NF53_2283) - 2313306..2313497 (+) 192 WP_050821832.1 hypothetical protein -
  NF53_RS31745 (NF53_2284) - 2313531..2314557 (+) 1027 Protein_2302 DNA cytosine methyltransferase -
  NF53_RS33675 (NF53_2285) - 2314590..2314760 (+) 171 WP_194793775.1 hypothetical protein -
  NF53_RS33680 (NF53_2286) - 2314776..2315048 (+) 273 WP_050821833.1 hypothetical protein -
  NF53_RS12045 (NF53_2287) - 2315035..2315679 (+) 645 WP_050821834.1 hypothetical protein -
  NF53_RS12050 (NF53_2288) - 2315706..2316023 (+) 318 WP_050821835.1 hypothetical protein -
  NF53_RS12055 (NF53_2289) - 2316040..2316939 (+) 900 WP_050821836.1 hypothetical protein -
  NF53_RS12060 (NF53_2290) - 2316942..2317088 (+) 147 WP_000790088.1 BC1881 family protein -
  NF53_RS12065 (NF53_2291) - 2317214..2317408 (+) 195 WP_042597799.1 hypothetical protein -
  NF53_RS34000 (NF53_2292) - 2317433..2317570 (+) 138 WP_228490619.1 hypothetical protein -
  NF53_RS34005 (NF53_2293) - 2317604..2317813 (+) 210 WP_228490618.1 hypothetical protein -
  NF53_RS12075 (NF53_2294) abrB 2317810..2318091 (+) 282 WP_000843025.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  NF53_RS12080 (NF53_2295) - 2318093..2318290 (+) 198 WP_050821837.1 hypothetical protein -
  NF53_RS12085 (NF53_2296) - 2318317..2318484 (+) 168 WP_050822200.1 hypothetical protein -
  NF53_RS12090 (NF53_2297) - 2318492..2319217 (-) 726 WP_050821838.1 hypothetical protein -
  NF53_RS12095 (NF53_2298) - 2319341..2319523 (+) 183 WP_050821839.1 DUF6877 family protein -
  NF53_RS12100 (NF53_2299) - 2319513..2319863 (+) 351 WP_050821840.1 hypothetical protein -
  NF53_RS12105 (NF53_2300) - 2320098..2320478 (+) 381 WP_050821841.1 hypothetical protein -
  NF53_RS12110 (NF53_2301) - 2320885..2321445 (+) 561 WP_050821842.1 recombinase family protein -
  NF53_RS12115 (NF53_2302) - 2321658..2322095 (+) 438 WP_050821843.1 hypothetical protein -
  NF53_RS12120 (NF53_2303) - 2322224..2322655 (+) 432 WP_003271424.1 phBC6A51 family helix-turn-helix protein -

Sequence


Protein


Download         Length: 93 a.a.        Molecular weight: 10244.87 Da        Isoelectric Point: 4.6282

>NTDB_id=134228 NF53_RS12075 WP_000843025.1 2317810..2318091(+) (abrB) [Bacillus thuringiensis serovar indiana strain HD521]
MKSTGIIRNIDPLGRIVVPMELRRTLGIQVKDPMEIFVDGESIILQKYNPNNSCQITGEVSEENIELAGGKLVLSPEGVD
QVLAELEARLKGR

Nucleotide


Download         Length: 282 bp        

>NTDB_id=134228 NF53_RS12075 WP_000843025.1 2317810..2318091(+) (abrB) [Bacillus thuringiensis serovar indiana strain HD521]
ATGAAATCAACAGGTATTATTCGTAACATTGATCCATTAGGACGTATTGTGGTTCCGATGGAATTACGCCGTACATTAGG
TATCCAGGTAAAGGATCCTATGGAGATTTTTGTAGATGGTGAATCTATTATTCTACAAAAGTATAATCCTAATAACTCTT
GCCAAATTACAGGAGAGGTTTCAGAAGAAAATATTGAACTAGCTGGCGGTAAACTCGTGCTAAGTCCTGAAGGGGTTGAT
CAGGTATTAGCGGAACTCGAAGCACGTTTGAAGGGGCGATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

62.637

97.849

0.613


Multiple sequence alignment