Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QU35_RS16475 Genome accession   NZ_CP010052
Coordinates   3257104..3257244 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3252104..3262244
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QU35_RS16450 (QU35_17250) yuxO 3252417..3252797 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  QU35_RS16455 (QU35_17255) comA 3252816..3253460 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QU35_RS16460 (QU35_17260) comP 3253541..3255850 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  QU35_RS16465 (QU35_17265) comX 3255865..3256032 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  QU35_RS16470 (QU35_17270) comQ 3256020..3256919 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  QU35_RS16475 (QU35_17275) degQ 3257104..3257244 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QU35_RS22595 - 3257466..3257591 (+) 126 WP_003228793.1 hypothetical protein -
  QU35_RS16480 (QU35_17280) - 3257705..3258073 (+) 369 WP_003243784.1 hypothetical protein -
  QU35_RS16485 (QU35_17285) pdeH 3258049..3259278 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  QU35_RS16490 (QU35_17290) pncB 3259415..3260887 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  QU35_RS16495 (QU35_17295) pncA 3260903..3261454 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  QU35_RS16500 (QU35_17300) yueI 3261551..3261949 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=133816 QU35_RS16475 WP_003220708.1 3257104..3257244(-) (degQ) [Bacillus subtilis subsp. subtilis str. 168]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=133816 QU35_RS16475 WP_003220708.1 3257104..3257244(-) (degQ) [Bacillus subtilis subsp. subtilis str. 168]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment