Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   QU35_RS12840 Genome accession   NZ_CP010052
Coordinates   2556148..2556522 (-) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   A0AAE2SIW8
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551148..2561522
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QU35_RS12800 (QU35_13430) yqhG 2551480..2552274 (+) 795 WP_003230200.1 YqhG family protein -
  QU35_RS12805 (QU35_13435) sinI 2552457..2552630 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QU35_RS12810 (QU35_13440) sinR 2552664..2552999 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QU35_RS12815 (QU35_13445) tasA 2553092..2553877 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  QU35_RS12820 (QU35_13450) sipW 2553941..2554513 (-) 573 WP_003246088.1 signal peptidase I SipW -
  QU35_RS12825 (QU35_13455) tapA 2554497..2555258 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  QU35_RS12830 (QU35_13460) yqzG 2555530..2555856 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QU35_RS12835 (QU35_13465) spoIITA 2555898..2556077 (-) 180 WP_003230176.1 YqzE family protein -
  QU35_RS12840 (QU35_13470) comGG 2556148..2556522 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  QU35_RS12845 (QU35_13475) comGF 2556523..2556906 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  QU35_RS12850 (QU35_13480) comGE 2556932..2557279 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  QU35_RS12855 (QU35_13485) comGD 2557263..2557694 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  QU35_RS12860 (QU35_13490) comGC 2557684..2557980 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QU35_RS12865 (QU35_13495) comGB 2557994..2559031 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  QU35_RS12870 (QU35_13500) comGA 2559018..2560088 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QU35_RS12875 (QU35_13510) corA 2560500..2561453 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=133792 QU35_RS12840 WP_003230170.1 2556148..2556522(-) (comGG) [Bacillus subtilis subsp. subtilis str. 168]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=133792 QU35_RS12840 WP_003230170.1 2556148..2556522(-) (comGG) [Bacillus subtilis subsp. subtilis str. 168]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment