Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   OY17_RS17720 Genome accession   NZ_CP009938
Coordinates   3646012..3646152 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus sp. BH072 isolate honey     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3641012..3651152
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OY17_RS17695 (OY17_17695) - 3641326..3641709 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  OY17_RS17700 (OY17_17700) comA 3641731..3642375 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  OY17_RS17705 (OY17_17705) comP 3642456..3644807 (-) 2352 WP_269800792.1 histidine kinase Regulator
  OY17_RS17710 (OY17_17710) comX 3644785..3644955 (-) 171 WP_032863917.1 competence pheromone ComX -
  OY17_RS17715 (OY17_17715) - 3644955..3645881 (-) 927 WP_014721741.1 polyprenyl synthetase family protein -
  OY17_RS17720 (OY17_17720) degQ 3646012..3646152 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  OY17_RS17725 (OY17_17725) - 3646618..3646959 (+) 342 WP_014418765.1 hypothetical protein -
  OY17_RS17730 (OY17_17730) - 3646966..3648189 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  OY17_RS17735 (OY17_17735) - 3648319..3649785 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  OY17_RS17740 (OY17_17740) - 3649803..3650354 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  OY17_RS17745 (OY17_17745) - 3650451..3650849 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=133177 OY17_RS17720 WP_003152043.1 3646012..3646152(-) (degQ) [Bacillus sp. BH072 isolate honey]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=133177 OY17_RS17720 WP_003152043.1 3646012..3646152(-) (degQ) [Bacillus sp. BH072 isolate honey]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment