Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | FORC5_RS12985 | Genome accession | NZ_CP009686 |
| Coordinates | 2555595..2555873 (+) | Length | 92 a.a. |
| NCBI ID | WP_046392727.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain FORC_005 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2545132..2589100 | 2555595..2555873 | within | 0 |
Gene organization within MGE regions
Location: 2545132..2589100
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC5_RS12920 (FORC5_2407) | - | 2545132..2545395 (+) | 264 | WP_016122577.1 | DUF3937 family protein | - |
| FORC5_RS12925 (FORC5_2408) | - | 2545951..2546271 (+) | 321 | WP_001071364.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| FORC5_RS29095 | - | 2546448..2546551 (+) | 104 | Protein_2474 | site-specific integrase | - |
| FORC5_RS12930 (FORC5_2409) | - | 2546761..2547246 (+) | 486 | WP_002024190.1 | hypothetical protein | - |
| FORC5_RS12935 (FORC5_2410) | - | 2547558..2548229 (+) | 672 | WP_046392719.1 | DUF3962 domain-containing protein | - |
| FORC5_RS12940 (FORC5_2411) | - | 2548298..2549407 (-) | 1110 | WP_046392720.1 | tyrosine-type recombinase/integrase | - |
| FORC5_RS12945 (FORC5_2413) | - | 2549711..2550949 (+) | 1239 | WP_046392721.1 | exosporium leader peptide-containing protein | - |
| FORC5_RS12950 (FORC5_2414) | - | 2551591..2552742 (+) | 1152 | WP_046392722.1 | AimR family lysis-lysogeny pheromone receptor | - |
| FORC5_RS12955 | - | 2552780..2552926 (+) | 147 | WP_046392723.1 | hypothetical protein | - |
| FORC5_RS29415 | - | 2553080..2553208 (+) | 129 | WP_000836783.1 | hypothetical protein | - |
| FORC5_RS12960 (FORC5_2415) | - | 2553246..2553599 (-) | 354 | WP_016095531.1 | helix-turn-helix transcriptional regulator | - |
| FORC5_RS12965 (FORC5_2416) | - | 2553800..2553991 (+) | 192 | WP_046392724.1 | helix-turn-helix transcriptional regulator | - |
| FORC5_RS12970 (FORC5_2417) | - | 2554048..2554314 (+) | 267 | WP_000522030.1 | helix-turn-helix domain-containing protein | - |
| FORC5_RS29100 (FORC5_2418) | - | 2554314..2554478 (+) | 165 | WP_046392725.1 | hypothetical protein | - |
| FORC5_RS12980 (FORC5_2419) | - | 2554536..2555591 (+) | 1056 | WP_046392726.1 | DnaD domain protein | - |
| FORC5_RS12985 (FORC5_2420) | abrB | 2555595..2555873 (+) | 279 | WP_046392727.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| FORC5_RS12990 (FORC5_2421) | - | 2555866..2556225 (+) | 360 | WP_016512772.1 | hypothetical protein | - |
| FORC5_RS12995 (FORC5_2422) | - | 2556244..2556411 (+) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| FORC5_RS13000 (FORC5_2423) | - | 2556437..2556688 (+) | 252 | WP_000109500.1 | hypothetical protein | - |
| FORC5_RS13005 (FORC5_2424) | - | 2556708..2557190 (+) | 483 | WP_046392728.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| FORC5_RS13010 (FORC5_2425) | - | 2557335..2558123 (-) | 789 | WP_046392729.1 | sulfotransferase family 2 domain-containing protein | - |
| FORC5_RS13015 (FORC5_2426) | - | 2558452..2558916 (-) | 465 | WP_046392730.1 | hypothetical protein | - |
| FORC5_RS13020 (FORC5_2427) | - | 2559740..2560309 (-) | 570 | WP_046392731.1 | cupin domain-containing protein | - |
| FORC5_RS13025 (FORC5_2428) | - | 2560506..2560973 (-) | 468 | WP_046392732.1 | hypothetical protein | - |
| FORC5_RS29105 | - | 2561879..2562019 (+) | 141 | WP_203225412.1 | hypothetical protein | - |
| FORC5_RS13035 (FORC5_2430) | - | 2562430..2562714 (-) | 285 | WP_001123250.1 | DUF4183 domain-containing protein | - |
| FORC5_RS28695 | - | 2563001..2563132 (+) | 132 | WP_116344833.1 | DUF3983 domain-containing protein | - |
| FORC5_RS29110 (FORC5_2431) | - | 2563237..2563407 (+) | 171 | WP_033695145.1 | hypothetical protein | - |
| FORC5_RS13045 (FORC5_2432) | - | 2563435..2563917 (+) | 483 | WP_046392734.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FORC5_RS13050 (FORC5_2433) | - | 2563917..2564459 (+) | 543 | WP_046392735.1 | site-specific integrase | - |
| FORC5_RS13055 (FORC5_2434) | - | 2564674..2565624 (+) | 951 | WP_001170296.1 | nucleoside hydrolase | - |
| FORC5_RS13060 (FORC5_2435) | - | 2566019..2566720 (+) | 702 | WP_046392736.1 | hypothetical protein | - |
| FORC5_RS13065 (FORC5_2436) | - | 2567264..2568016 (+) | 753 | WP_046392737.1 | hypothetical protein | - |
| FORC5_RS13070 (FORC5_2437) | - | 2568060..2568239 (+) | 180 | WP_046392738.1 | hypothetical protein | - |
| FORC5_RS13075 (FORC5_2438) | - | 2568253..2568504 (+) | 252 | WP_046392739.1 | hypothetical protein | - |
| FORC5_RS13080 (FORC5_2439) | - | 2568501..2568815 (+) | 315 | WP_046392740.1 | hypothetical protein | - |
| FORC5_RS13085 (FORC5_2440) | - | 2568820..2569050 (+) | 231 | WP_046392741.1 | hypothetical protein | - |
| FORC5_RS13090 (FORC5_2441) | - | 2569043..2569378 (+) | 336 | WP_046392742.1 | HNH endonuclease signature motif containing protein | - |
| FORC5_RS13095 (FORC5_2442) | - | 2569502..2569813 (+) | 312 | WP_016125621.1 | P27 family phage terminase small subunit | - |
| FORC5_RS13100 (FORC5_2443) | - | 2569810..2571495 (+) | 1686 | WP_016125622.1 | terminase large subunit | - |
| FORC5_RS13105 (FORC5_2444) | - | 2571516..2572667 (+) | 1152 | WP_046392743.1 | phage portal protein | - |
| FORC5_RS13110 (FORC5_2445) | - | 2572657..2573382 (+) | 726 | WP_000791073.1 | head maturation protease, ClpP-related | - |
| FORC5_RS13115 (FORC5_2446) | - | 2573433..2574575 (+) | 1143 | WP_086401347.1 | phage major capsid protein | - |
| FORC5_RS13120 (FORC5_2447) | - | 2574588..2574881 (+) | 294 | WP_016125626.1 | hypothetical protein | - |
| FORC5_RS13125 (FORC5_2448) | - | 2574883..2575233 (+) | 351 | WP_023522880.1 | phage head closure protein | - |
| FORC5_RS13130 (FORC5_2449) | - | 2575235..2575579 (+) | 345 | WP_025710295.1 | HK97 gp10 family phage protein | - |
| FORC5_RS13135 (FORC5_2450) | - | 2575576..2575905 (+) | 330 | WP_046392744.1 | hypothetical protein | - |
| FORC5_RS13140 (FORC5_2451) | - | 2575906..2576493 (+) | 588 | WP_046392745.1 | major tail protein | - |
| FORC5_RS13145 (FORC5_2452) | - | 2576498..2576860 (+) | 363 | WP_046392746.1 | hypothetical protein | - |
| FORC5_RS29115 (FORC5_2453) | - | 2576914..2577075 (+) | 162 | WP_044798004.1 | hypothetical protein | - |
| FORC5_RS13155 (FORC5_2454) | - | 2577091..2578548 (+) | 1458 | Protein_2522 | DUF2207 domain-containing protein | - |
| FORC5_RS13160 (FORC5_2455) | - | 2578772..2580937 (+) | 2166 | WP_046392748.1 | phage tail tape measure protein, TP901 family, core region | - |
| FORC5_RS13165 (FORC5_2456) | - | 2580979..2582436 (+) | 1458 | WP_046392749.1 | distal tail protein Dit | - |
| FORC5_RS13170 (FORC5_2457) | - | 2582433..2587532 (+) | 5100 | WP_046392750.1 | phage tail spike protein | - |
| FORC5_RS13175 (FORC5_2458) | - | 2587544..2587924 (+) | 381 | WP_046392751.1 | hypothetical protein | - |
| FORC5_RS13180 (FORC5_2459) | - | 2587959..2588384 (+) | 426 | WP_046392752.1 | phage holin family protein | - |
| FORC5_RS13185 (FORC5_2460) | - | 2588384..2589100 (+) | 717 | WP_046392753.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10231.85 Da Isoelectric Point: 6.2246
>NTDB_id=131211 FORC5_RS12985 WP_046392727.1 2555595..2555873(+) (abrB) [Bacillus cereus strain FORC_005]
MKNTGVARKVDELGRVVIPVELRRTLGINEGTALDFHVDGENIVLRRHEKSCFVTGEVFENNIELLGGRMFLSKEGVIEL
LDLIQKSGMAHA
MKNTGVARKVDELGRVVIPVELRRTLGINEGTALDFHVDGENIVLRRHEKSCFVTGEVFENNIELLGGRMFLSKEGVIEL
LDLIQKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=131211 FORC5_RS12985 WP_046392727.1 2555595..2555873(+) (abrB) [Bacillus cereus strain FORC_005]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
CATTAACGAAGGAACGGCACTAGATTTTCATGTCGATGGTGAAAACATCGTTTTAAGAAGACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTTTGAAAACAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGTAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
CATTAACGAAGGAACGGCACTAGATTTTCATGTCGATGGTGAAAACATCGTTTTAAGAAGACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTTTGAAAACAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGTAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
56.322 |
94.565 |
0.533 |