Detailed information    

insolico Bioinformatically predicted

Overview

Name   braS   Type   Regulator
Locus tag   EP23_RS21405 Genome accession   NZ_CP009623
Coordinates   1870981..1871895 (-) Length   304 a.a.
NCBI ID   WP_171509147.1    Uniprot ID   -
Organism   Staphylococcus agnetis strain 908     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1794745..1871756 1870981..1871895 flank -775


Gene organization within MGE regions


Location: 1794745..1871895
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EP23_RS21090 (EP23_08950) - 1794823..1795575 (+) 753 WP_060551986.1 sulfite exporter TauE/SafE family protein -
  EP23_RS21095 (EP23_08955) merA 1795635..1796957 (-) 1323 WP_060551987.1 hypothiocyanous acid reductase MerA -
  EP23_RS21100 (EP23_08960) hypR 1796954..1797382 (-) 429 WP_060551988.1 redox-sensitive transcriptional regulator HypR -
  EP23_RS21105 (EP23_08965) - 1797879..1798337 (-) 459 WP_060552516.1 AAA family ATPase -
  EP23_RS21110 (EP23_08970) - 1798348..1799013 (-) 666 WP_060551989.1 ABC transporter ATP-binding protein -
  EP23_RS21115 (EP23_08975) - 1799025..1800074 (-) 1050 WP_060551990.1 ABC transporter permease -
  EP23_RS21120 (EP23_08980) - 1800277..1801851 (+) 1575 WP_060551991.1 CoA-transferase -
  EP23_RS21125 (EP23_08985) - 1801927..1803432 (+) 1506 WP_060551992.1 class I adenylate-forming enzyme family protein -
  EP23_RS21130 (EP23_08990) - 1803492..1804700 (+) 1209 WP_060551993.1 acyl-CoA dehydrogenase family protein -
  EP23_RS21135 (EP23_08995) - 1804728..1806989 (+) 2262 WP_060551994.1 3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase family protein -
  EP23_RS21140 (EP23_09000) - 1807012..1808196 (+) 1185 WP_060551995.1 thiolase family protein -
  EP23_RS21145 (EP23_09005) - 1808255..1809145 (-) 891 WP_060551996.1 PhzF family phenazine biosynthesis protein -
  EP23_RS21150 (EP23_09010) gtfB 1809413..1810753 (-) 1341 WP_060551997.1 accessory Sec system glycosylation chaperone GtfB -
  EP23_RS21155 (EP23_09015) gtfA 1810746..1812254 (-) 1509 WP_060551998.1 accessory Sec system glycosyltransferase GtfA -
  EP23_RS21160 (EP23_09020) secA2 1812270..1814660 (-) 2391 WP_060551999.1 accessory Sec system translocase SecA2 -
  EP23_RS21165 (EP23_12565) asp3 1814650..1815555 (-) 906 WP_060552000.1 accessory Sec system protein Asp3 -
  EP23_RS21170 (EP23_09030) asp2 1815542..1817104 (-) 1563 WP_060552001.1 accessory Sec system protein Asp2 -
  EP23_RS21175 (EP23_09035) asp1 1817094..1818650 (-) 1557 WP_060552002.1 accessory Sec system protein Asp1 -
  EP23_RS21180 (EP23_09040) secY2 1818661..1819884 (-) 1224 WP_060552003.1 accessory Sec system protein translocase subunit SecY2 -
  EP23_RS24735 - 1819997..1822903 (-) 2907 Protein_1767 LPXTG cell wall anchor domain-containing protein -
  EP23_RS24700 - 1824722..1824820 (-) 99 Protein_1768 KxYKxGKxW signal peptide domain-containing protein -
  EP23_RS21190 (EP23_09055) - 1825742..1827334 (+) 1593 WP_060552006.1 L-lactate permease -
  EP23_RS21195 (EP23_09060) - 1827370..1828050 (-) 681 WP_060552007.1 6-carboxyhexanoate--CoA ligase -
  EP23_RS21200 (EP23_09065) - 1828043..1829155 (-) 1113 WP_060552008.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
  EP23_RS21205 (EP23_09070) bioA 1829158..1830507 (-) 1350 WP_060552009.1 adenosylmethionine--8-amino-7-oxononanoate transaminase -
  EP23_RS21210 (EP23_09075) bioD 1830482..1831174 (-) 693 WP_060552010.1 dethiobiotin synthase -
  EP23_RS21215 (EP23_12575) - 1831569..1832039 (-) 471 WP_240186783.1 IS30 family transposase -
  EP23_RS21220 (EP23_09085) - 1832077..1832589 (-) 513 WP_060552012.1 helix-turn-helix domain-containing protein -
  EP23_RS21225 (EP23_09090) - 1832700..1833053 (-) 354 WP_060552013.1 cystatin-like fold lipoprotein -
  EP23_RS21230 (EP23_09095) - 1833113..1833703 (-) 591 WP_060552014.1 hypothetical protein -
  EP23_RS21235 (EP23_09100) - 1833708..1834757 (-) 1050 WP_060552015.1 CHAP domain-containing protein -
  EP23_RS21240 (EP23_09105) - 1834747..1836642 (-) 1896 WP_060552016.1 CD3337/EF1877 family mobilome membrane protein -
  EP23_RS21245 (EP23_09110) - 1836647..1836910 (-) 264 WP_031838453.1 hypothetical protein -
  EP23_RS21250 (EP23_09115) - 1836950..1837177 (-) 228 WP_031838454.1 hypothetical protein -
  EP23_RS21255 (EP23_09120) - 1837208..1838578 (-) 1371 WP_060552017.1 FtsK/SpoIIIE domain-containing protein -
  EP23_RS21260 (EP23_09125) - 1838605..1838883 (-) 279 WP_031796727.1 hypothetical protein -
  EP23_RS21265 (EP23_12580) - 1838935..1839087 (-) 153 WP_167337564.1 hypothetical protein -
  EP23_RS21270 (EP23_09130) - 1839154..1840332 (-) 1179 WP_031796728.1 XRE family transcriptional regulator -
  EP23_RS21275 (EP23_09135) - 1840355..1841092 (-) 738 WP_031796729.1 hypothetical protein -
  EP23_RS21280 (EP23_09140) - 1841206..1843701 (-) 2496 WP_060552018.1 ATP-binding protein -
  EP23_RS21285 (EP23_09145) - 1843738..1844121 (-) 384 WP_060552019.1 TcpE family conjugal transfer membrane protein -
  EP23_RS21290 (EP23_09150) - 1844128..1844388 (-) 261 WP_060552020.1 TcpD family membrane protein -
  EP23_RS21295 (EP23_09155) - 1844393..1845439 (-) 1047 WP_420894717.1 conjugal transfer protein -
  EP23_RS21300 (EP23_09160) - 1845518..1846597 (-) 1080 WP_060552022.1 replication initiation factor domain-containing protein -
  EP23_RS21305 (EP23_09165) - 1846767..1847072 (-) 306 WP_060552023.1 hypothetical protein -
  EP23_RS21310 (EP23_09170) - 1847086..1847406 (-) 321 WP_060552024.1 DUF961 family protein -
  EP23_RS21315 (EP23_09175) - 1847553..1847837 (-) 285 WP_060552025.1 hypothetical protein -
  EP23_RS21320 (EP23_09180) - 1847931..1848371 (+) 441 WP_060552026.1 LytTR family DNA-binding domain-containing protein -
  EP23_RS21325 (EP23_09185) - 1848368..1848826 (+) 459 WP_060552027.1 DUF3021 domain-containing protein -
  EP23_RS24740 (EP23_09190) - 1849100..1850605 (+) 1506 Protein_1797 glycoside hydrolase family 3 N-terminal domain-containing protein -
  EP23_RS21335 (EP23_09195) - 1850816..1852138 (+) 1323 WP_060552028.1 Nramp family divalent metal transporter -
  EP23_RS21340 (EP23_09200) - 1852220..1853221 (-) 1002 WP_060552029.1 hypothetical protein -
  EP23_RS21345 (EP23_09205) cas2 1853235..1853543 (-) 309 WP_165805128.1 CRISPR-associated endonuclease Cas2 -
  EP23_RS21350 (EP23_09210) cas1 1853548..1854450 (-) 903 WP_060552031.1 type II CRISPR-associated endonuclease Cas1 -
  EP23_RS21355 (EP23_09215) cas9 1854450..1857617 (-) 3168 WP_060552032.1 type II CRISPR RNA-guided endonuclease Cas9 -
  EP23_RS21360 (EP23_09220) - 1860367..1860789 (+) 423 WP_060552033.1 Hsp20/alpha crystallin family protein -
  EP23_RS21365 (EP23_12585) - 1860858..1860995 (-) 138 WP_156407416.1 hypothetical protein -
  EP23_RS21370 (EP23_09225) - 1861177..1862838 (+) 1662 WP_060552034.1 FAD-binding dehydrogenase -
  EP23_RS21375 (EP23_09230) mbcS 1863262..1864851 (-) 1590 WP_060552035.1 acyl-CoA synthetase MbcS -
  EP23_RS21380 (EP23_09235) argF 1865358..1866368 (-) 1011 WP_370672127.1 ornithine carbamoyltransferase -
  EP23_RS21385 (EP23_09240) spn 1866763..1867083 (+) 321 WP_060552037.1 SPIN family peroxidase inhibitor -
  EP23_RS21390 (EP23_09245) - 1867315..1867941 (+) 627 WP_060552038.1 FMN-dependent NADH-azoreductase -
  EP23_RS21395 (EP23_09250) - 1868179..1870140 (-) 1962 WP_060552039.1 ABC transporter permease -
  EP23_RS21400 (EP23_09255) - 1870142..1870891 (-) 750 WP_060552040.1 ABC transporter ATP-binding protein -
  EP23_RS21405 (EP23_09260) braS 1870981..1871895 (-) 915 WP_171509147.1 sensor histidine kinase Regulator

Sequence

Protein


Download         Length: 304 a.a.        Molecular weight: 35693.55 Da        Isoelectric Point: 7.6807

>NTDB_id=130839 EP23_RS21405 WP_171509147.1 1870981..1871895(-) (braS) [Staphylococcus agnetis strain 908]
MRHLRFYTHIFSDICIYVLMLMLFLFISFIYGLEVEAYILILSVSLFVFSLYIAVKWVYFKKQETLKQINTRLEDELQDV
KTKHRHYQRDLEHYFLTWVHQIKTPITASKLLLERNEAGMVNRVRQEITEIENYTNLALNYLKLLSHETDMVVQKVALED
IVKPLIQRYALHFIEHRTRIHTEHLNCEVTTDAQWIKIMIEQILNNALKYAKGGDIWIVFDAQQHTLTIKDNGIGINKVD
LPKIFEKGYSGTNGRLNDKSSGIGLFIVKEISEKLHHPIAVQSEPGIYTEFTIQFPKPSHLTNM

Nucleotide


Download         Length: 915 bp        

>NTDB_id=130839 EP23_RS21405 WP_171509147.1 1870981..1871895(-) (braS) [Staphylococcus agnetis strain 908]
GTGAGGCACTTGCGTTTTTATACTCATATTTTTAGTGATATATGCATATACGTGCTCATGTTAATGTTATTTTTATTTAT
ATCATTCATCTATGGTCTTGAAGTAGAAGCATATATATTGATTTTAAGCGTGTCGCTATTTGTTTTCAGCTTGTATATCG
CTGTGAAATGGGTTTATTTTAAAAAGCAAGAAACATTAAAACAAATCAATACGCGCCTAGAAGATGAATTGCAAGACGTT
AAAACAAAACATCGTCACTATCAACGAGATTTAGAGCATTATTTTTTAACGTGGGTGCATCAAATTAAAACGCCAATTAC
TGCCTCTAAACTTTTATTAGAACGTAATGAAGCGGGGATGGTGAACCGCGTACGTCAAGAAATCACAGAAATTGAAAATT
ATACTAATTTGGCACTGAATTACTTAAAATTGTTAAGCCATGAAACCGACATGGTGGTCCAAAAAGTGGCGCTTGAAGAT
ATCGTCAAACCATTAATCCAACGATATGCATTACATTTTATTGAACATCGTACACGCATTCATACAGAGCACCTTAATTG
TGAGGTGACGACAGACGCCCAATGGATCAAGATTATGATTGAACAAATTTTAAATAATGCACTCAAATACGCTAAAGGTG
GCGATATTTGGATTGTATTCGATGCGCAACAACACACACTCACAATTAAAGATAACGGTATCGGTATCAATAAGGTCGAT
TTGCCAAAGATATTTGAAAAAGGGTATTCCGGGACGAATGGTCGTTTGAATGACAAATCTAGTGGAATAGGATTGTTTAT
TGTGAAAGAAATTTCAGAGAAACTGCATCATCCTATAGCTGTTCAATCAGAACCTGGCATATATACAGAATTTACGATTC
AGTTTCCGAAACCATCTCATCTTACAAATATGTAA

Domains

Predicted by InterproScan.

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (HATPase_c)

(192-297)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  braS Staphylococcus aureus N315

50.171

96.382

0.484

Multiple sequence alignment