Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   PODO_RS22420 Genome accession   NZ_CP009428
Coordinates   5120386..5120817 (+) Length   143 a.a.
NCBI ID   WP_036683407.1    Uniprot ID   A0A1R0X267
Organism   Paenibacillus odorifer strain DSM 15391     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 5088982..5129538 5120386..5120817 within 0


Gene organization within MGE regions


Location: 5088982..5129538
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PODO_RS22220 (PODO_22840) - 5088982..5089458 (-) 477 WP_038572782.1 GNAT family N-acetyltransferase -
  PODO_RS22225 (PODO_22845) - 5089854..5090492 (-) 639 WP_038572784.1 hypothetical protein -
  PODO_RS22230 (PODO_22850) - 5090656..5090850 (+) 195 Protein_4456 MBL fold metallo-hydrolase -
  PODO_RS31265 - 5091096..5091272 (-) 177 WP_141240374.1 YolD-like family protein -
  PODO_RS22240 - 5091286..5091573 (-) 288 WP_052097252.1 hypothetical protein -
  PODO_RS22245 (PODO_22865) - 5091566..5091763 (-) 198 WP_038572786.1 hypothetical protein -
  PODO_RS22250 (PODO_22870) - 5091972..5092829 (+) 858 WP_038572787.1 discoidin domain-containing protein -
  PODO_RS30165 - 5092852..5093127 (-) 276 WP_052097255.1 hypothetical protein -
  PODO_RS22255 (PODO_22875) - 5093170..5093454 (-) 285 WP_143759087.1 M15 family metallopeptidase -
  PODO_RS31270 - 5093691..5093861 (-) 171 WP_143759088.1 hypothetical protein -
  PODO_RS22260 (PODO_22885) - 5095336..5096520 (-) 1185 WP_038572788.1 M48 family metalloprotease -
  PODO_RS22265 - 5096592..5097659 (-) 1068 WP_052097258.1 hypothetical protein -
  PODO_RS22270 (PODO_22895) - 5097757..5099340 (-) 1584 WP_244886376.1 LA2681 family HEPN domain-containing protein -
  PODO_RS32010 - 5099515..5099694 (-) 180 WP_244886377.1 hypothetical protein -
  PODO_RS32015 (PODO_22905) - 5099998..5100348 (-) 351 WP_038572789.1 hypothetical protein -
  PODO_RS22285 (PODO_22910) - 5100970..5101344 (-) 375 WP_155288170.1 hypothetical protein -
  PODO_RS22290 (PODO_22920) - 5102863..5103072 (-) 210 WP_141240286.1 hypothetical protein -
  PODO_RS22295 (PODO_22925) - 5103493..5103687 (+) 195 WP_038572792.1 hypothetical protein -
  PODO_RS22300 - 5104068..5104373 (-) 306 WP_342342261.1 DUF2513 domain-containing protein -
  PODO_RS22305 (PODO_22935) - 5104357..5104575 (-) 219 WP_038572793.1 helix-turn-helix transcriptional regulator -
  PODO_RS30175 - 5104681..5105025 (-) 345 WP_052097262.1 helix-turn-helix transcriptional regulator -
  PODO_RS22315 (PODO_22945) - 5105059..5105757 (-) 699 WP_244886378.1 metallophosphoesterase family protein -
  PODO_RS31280 - 5105802..5105969 (-) 168 WP_155288171.1 hypothetical protein -
  PODO_RS22320 (PODO_22955) - 5106001..5106309 (-) 309 WP_038572795.1 hypothetical protein -
  PODO_RS22325 - 5106567..5107031 (-) 465 WP_052097264.1 hypothetical protein -
  PODO_RS31285 - 5107082..5107249 (-) 168 WP_155288172.1 hypothetical protein -
  PODO_RS22330 (PODO_22970) - 5107291..5107743 (-) 453 WP_038572797.1 GIY-YIG nuclease family protein -
  PODO_RS22335 (PODO_22975) - 5107774..5108217 (-) 444 WP_038572799.1 AAA family ATPase -
  PODO_RS22340 (PODO_22980) - 5108219..5108956 (-) 738 WP_038572800.1 tRNA(His) guanylyltransferase Thg1 family protein -
  PODO_RS22345 (PODO_22985) - 5109001..5109777 (-) 777 WP_038572802.1 RNA ligase family protein -
  PODO_RS22350 (PODO_22995) - 5110417..5110779 (-) 363 WP_038572804.1 cyclic-phosphate processing receiver domain-containing protein -
  PODO_RS22355 (PODO_23000) - 5110850..5111242 (-) 393 WP_038572806.1 hypothetical protein -
  PODO_RS22360 (PODO_23005) - 5111232..5111495 (-) 264 WP_038572807.1 hypothetical protein -
  PODO_RS22365 (PODO_23010) - 5111871..5112740 (-) 870 WP_038572809.1 DUF2971 domain-containing protein -
  PODO_RS22370 (PODO_23015) - 5112806..5113039 (-) 234 WP_038572810.1 hypothetical protein -
  PODO_RS31290 - 5113133..5113276 (-) 144 WP_169744798.1 hypothetical protein -
  PODO_RS32020 - 5113525..5113800 (-) 276 WP_244886379.1 site-specific integrase -
  PODO_RS32025 - 5114012..5114491 (-) 480 WP_244886380.1 hypothetical protein -
  PODO_RS32030 - 5114914..5115390 (-) 477 WP_052097266.1 WGxxGxxG-CTERM domain-containing protein -
  PODO_RS22390 (PODO_23040) - 5115466..5116152 (-) 687 WP_038572812.1 M15 family metallopeptidase -
  PODO_RS31560 - 5116269..5116433 (+) 165 WP_169744799.1 hypothetical protein -
  PODO_RS22395 (PODO_23050) - 5116430..5116765 (-) 336 WP_038572814.1 YolD-like family protein -
  PODO_RS22400 (PODO_23055) - 5116973..5117533 (-) 561 WP_038572817.1 hypothetical protein -
  PODO_RS22405 - 5117651..5118139 (+) 489 WP_036683346.1 PH domain-containing protein -
  PODO_RS22410 (PODO_23065) - 5118213..5119688 (-) 1476 WP_038572819.1 glycosyl hydrolase -
  PODO_RS22415 (PODO_23070) - 5119863..5120279 (-) 417 WP_038572821.1 cytidine deaminase -
  PODO_RS22420 (PODO_23075) nucA/comI 5120386..5120817 (+) 432 WP_036683407.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  PODO_RS31295 - 5120899..5121048 (-) 150 WP_155288175.1 hypothetical protein -
  PODO_RS30710 - 5121198..5121374 (+) 177 WP_076098563.1 YjfB family protein -
  PODO_RS22425 (PODO_23090) - 5121538..5122089 (+) 552 WP_038574762.1 ImmA/IrrE family metallo-endopeptidase -
  PODO_RS31300 - 5122156..5122317 (+) 162 WP_155288176.1 hypothetical protein -
  PODO_RS31305 - 5122401..5122547 (-) 147 WP_155288177.1 hypothetical protein -
  PODO_RS22430 (PODO_23105) - 5122657..5122992 (+) 336 WP_036683354.1 hypothetical protein -
  PODO_RS22435 (PODO_23110) - 5123437..5123931 (+) 495 WP_038572823.1 sigma-70 family RNA polymerase sigma factor -
  PODO_RS22440 (PODO_23115) - 5123928..5124917 (+) 990 WP_038572825.1 hypothetical protein -
  PODO_RS31750 (PODO_23120) - 5124896..5125234 (+) 339 WP_218918659.1 hypothetical protein -
  PODO_RS22450 (PODO_23125) - 5125491..5126417 (-) 927 WP_155288178.1 IS3 family transposase -
  PODO_RS22455 (PODO_23130) - 5126366..5126683 (-) 318 WP_036683594.1 transposase -
  PODO_RS30720 - 5127090..5128648 (+) 1559 WP_094903917.1 IS3 family transposase -
  PODO_RS22470 (PODO_23145) - 5128864..5129538 (+) 675 WP_036683363.1 hypothetical protein -

Sequence

Protein


Download         Length: 143 a.a.        Molecular weight: 15898.68 Da        Isoelectric Point: 4.3968

>NTDB_id=129233 PODO_RS22420 WP_036683407.1 5120386..5120817(+) (nucA/comI) [Paenibacillus odorifer strain DSM 15391]
MKKWISSLIIVALLALASYWFEQNGEPTDPSSPSNSSVVQLTFPSDRYPETAKHIQDAIAKGESATCTINREQAEENRKE
SLKGIPTKKGYDRDEWPMAMCEEGGVGADIEYITPSDNRGAGSWVGNQLEDYADGTRVEFMFK

Nucleotide


Download         Length: 432 bp        

>NTDB_id=129233 PODO_RS22420 WP_036683407.1 5120386..5120817(+) (nucA/comI) [Paenibacillus odorifer strain DSM 15391]
GTGAAAAAATGGATCTCCAGTCTCATCATTGTTGCATTACTTGCTTTGGCTAGTTACTGGTTTGAACAAAACGGAGAGCC
TACAGACCCCTCGTCTCCATCCAATTCGAGTGTTGTTCAGCTAACCTTCCCATCAGACCGCTATCCTGAGACCGCCAAGC
ATATTCAGGATGCCATTGCGAAAGGTGAATCCGCCACATGTACGATTAACCGAGAGCAGGCTGAAGAGAACCGCAAAGAG
TCCTTAAAAGGGATCCCTACTAAAAAGGGATATGACCGGGATGAATGGCCAATGGCTATGTGTGAGGAAGGCGGCGTTGG
TGCCGACATTGAATACATAACGCCAAGCGATAACCGCGGGGCAGGAAGCTGGGTTGGCAATCAGCTGGAGGATTATGCAG
ACGGAACCCGGGTGGAATTTATGTTTAAATAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(46-139)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1R0X267

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

68.932

72.028

0.497

Multiple sequence alignment