Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   CLPA_RS21060 Genome accession   NZ_CP009268
Coordinates   840577..840741 (+) Length   54 a.a.
NCBI ID   WP_257786243.1    Uniprot ID   -
Organism   Clostridium pasteurianum DSM 525 = ATCC 6013 strain DSM 525     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Genomic Context

Location: 835577..845741
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CLPA_RS21580 (CLPA_c07600) - 835698..836177 (+) 480 WP_257786242.1 RHS repeat-associated core domain-containing protein -
  CLPA_RS03670 (CLPA_c07610) - 836203..836532 (+) 330 WP_003441125.1 transposase -
  CLPA_RS03675 (CLPA_c07620) - 836577..837458 (+) 882 WP_003441126.1 IS3 family transposase -
  CLPA_RS03680 (CLPA_c07630) - 837571..838017 (+) 447 WP_003446350.1 DUF2691 family protein -
  CLPA_RS03685 (CLPA_c07640) - 837986..838333 (+) 348 WP_003446349.1 hypothetical protein -
  CLPA_RS20015 (CLPA_c07650) - 838595..839500 (+) 906 WP_003446348.1 RHS repeat-associated core domain-containing protein -
  CLPA_RS03695 (CLPA_c07660) - 839541..839894 (+) 354 WP_236900378.1 immunity 53 family protein -
  CLPA_RS03700 (CLPA_c07670) - 840054..840398 (+) 345 WP_003446346.1 hypothetical protein -
  CLPA_RS21060 nucA/comI 840577..840741 (+) 165 WP_257786243.1 hypothetical protein Machinery gene
  CLPA_RS03710 (CLPA_c07680) - 840768..841415 (+) 648 WP_003446344.1 DUF2625 family protein -
  CLPA_RS03715 (CLPA_c07690) - 841763..842617 (+) 855 WP_003446342.1 hypothetical protein -
  CLPA_RS03720 (CLPA_c07700) - 842714..843487 (+) 774 WP_003446340.1 hypothetical protein -
  CLPA_RS21995 (CLPA_c07710) - 843647..844069 (+) 423 WP_003446338.1 DUF4351 domain-containing protein -
  CLPA_RS03730 (CLPA_c07720) - 844287..845105 (+) 819 WP_003446336.1 alpha/beta hydrolase -
  CLPA_RS03735 (CLPA_c07730) - 845438..845719 (+) 282 WP_003446334.1 hypothetical protein -

Sequence

Protein


Download         Length: 54 a.a.        Molecular weight: 5830.71 Da        Isoelectric Point: 12.1548

>NTDB_id=127923 CLPA_RS21060 WP_257786243.1 840577..840741(+) (nucA/comI) [Clostridium pasteurianum DSM 525 = ATCC 6013 strain DSM 525]
MSRHKYPSAMFRKGGMGASVRPFSPSDNRGAGSALGHKLRAFPDGTRVRIKIGD

Nucleotide


Download         Length: 165 bp        

>NTDB_id=127923 CLPA_RS21060 WP_257786243.1 840577..840741(+) (nucA/comI) [Clostridium pasteurianum DSM 525 = ATCC 6013 strain DSM 525]
ATTTCAAGACATAAATATCCTTCAGCAATGTTTAGAAAAGGTGGAATGGGAGCGAGTGTAAGACCATTTTCACCTTCTGA
TAATAGAGGAGCTGGTTCTGCATTAGGTCATAAATTAAGAGCATTCCCAGATGGAACAAGAGTAAGAATTAAAATTGGTG
ATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

56

92.593

0.519

Multiple sequence alignment