Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPYLSS1_RS00215 Genome accession   NZ_CP009259
Coordinates   37275..37388 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori SS1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32275..42388
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPYLSS1_RS00190 (HPYLSS1_00034) - 32328..34553 (+) 2226 WP_077231616.1 AAA family ATPase -
  HPYLSS1_RS00195 (HPYLSS1_00035) panD 34543..34896 (+) 354 WP_000142235.1 aspartate 1-decarboxylase -
  HPYLSS1_RS00200 (HPYLSS1_00036) - 34899..35201 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HPYLSS1_RS00205 (HPYLSS1_00037) - 35201..36196 (+) 996 WP_077231617.1 PDZ domain-containing protein -
  HPYLSS1_RS00210 (HPYLSS1_00038) comB6 36204..37259 (+) 1056 WP_077231618.1 P-type conjugative transfer protein TrbL Machinery gene
  HPYLSS1_RS00215 (HPYLSS1_00039) comB7 37275..37388 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HPYLSS1_RS00220 (HPYLSS1_00040) comB8 37385..38128 (+) 744 WP_001208396.1 type IV secretion system protein Machinery gene
  HPYLSS1_RS00225 (HPYLSS1_00041) comB9 38128..39108 (+) 981 WP_077231619.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPYLSS1_RS00230 (HPYLSS1_00042) comB10 39101..40231 (+) 1131 WP_077231620.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPYLSS1_RS00235 (HPYLSS1_00043) - 40302..41714 (+) 1413 WP_077231621.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=127779 HPYLSS1_RS00215 WP_001217873.1 37275..37388(+) (comB7) [Helicobacter pylori SS1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=127779 HPYLSS1_RS00215 WP_001217873.1 37275..37388(+) (comB7) [Helicobacter pylori SS1]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment