Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   WV34_RS01950 Genome accession   NZ_CP011252
Coordinates   382808..382927 (+) Length   39 a.a.
NCBI ID   WP_013351005.1    Uniprot ID   A0A150F3U5
Organism   Bacillus amyloliquefaciens strain MT45     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 377808..387927
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WV34_RS01935 (WV34_01905) - 379420..380103 (+) 684 WP_088612146.1 response regulator transcription factor -
  WV34_RS01940 (WV34_01910) - 380090..381517 (+) 1428 WP_162495005.1 HAMP domain-containing sensor histidine kinase -
  WV34_RS01945 (WV34_01915) rapC 381676..382824 (+) 1149 WP_088612148.1 tetratricopeptide repeat protein Regulator
  WV34_RS01950 (WV34_01920) phrC 382808..382927 (+) 120 WP_013351005.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  WV34_RS01955 (WV34_01925) - 383075..383176 (-) 102 WP_013351006.1 YjcZ family sporulation protein -
  WV34_RS01960 (WV34_01930) - 383271..384635 (-) 1365 WP_088612149.1 aspartate kinase -
  WV34_RS01965 (WV34_01935) ceuB 385049..386002 (+) 954 WP_013351008.1 ABC transporter permease Machinery gene
  WV34_RS01970 (WV34_01940) - 385992..386939 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  WV34_RS01975 (WV34_01945) - 386933..387691 (+) 759 WP_088612150.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=126743 WV34_RS01950 WP_013351005.1 382808..382927(+) (phrC) [Bacillus amyloliquefaciens strain MT45]
MKLKSKWFVICLAAAAIFTAAGVSQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=126743 WV34_RS01950 WP_013351005.1 382808..382927(+) (phrC) [Bacillus amyloliquefaciens strain MT45]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGCTGCAGGTGTAAGCCAGACAGA
TCAGGCTGAATTCCATGTGGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A150F3U5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

80

100

0.821


Multiple sequence alignment