Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   A610_RS05695 Genome accession   NZ_CP009050
Coordinates   1115615..1116244 (+) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli NCCP15648     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1090933..1121002 1115615..1116244 within 0


Gene organization within MGE regions


Location: 1090933..1121002
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A610_RS05580 (A610_1026) - 1090933..1093023 (-) 2091 WP_000289277.1 Mu transposase C-terminal domain-containing protein -
  A610_RS05585 - 1093025..1093273 (-) 249 WP_001310454.1 helix-turn-helix domain-containing protein -
  A610_RS05590 (A610_1027) - 1093463..1093993 (+) 531 WP_000077538.1 hypothetical protein -
  A610_RS05595 (A610_1028) - 1094246..1096294 (+) 2049 Protein_1028 fimbrial biogenesis usher protein -
  A610_RS05600 (A610_1029) elfG 1096285..1097355 (+) 1071 WP_001165657.1 fimbrial protein -
  A610_RS05605 (A610_1030) ycbU 1097367..1097909 (+) 543 WP_000730614.1 fimbrial protein -
  A610_RS05610 (A610_1031) ycbV 1097917..1098432 (+) 516 WP_000919489.1 fimbrial protein -
  A610_RS05615 (A610_1032) ycbF 1098398..1099135 (+) 738 WP_001111470.1 fimbrial chaperone -
  A610_RS05620 (A610_1033) pyrD 1099246..1100256 (+) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  A610_RS05625 (A610_1034) zapC 1100430..1100972 (+) 543 WP_001295353.1 cell division protein ZapC -
  A610_RS05630 (A610_1035) ycbX 1100969..1102078 (-) 1110 WP_000258204.1 6-N-hydroxylaminopurine resistance protein YcbX -
  A610_RS05635 (A610_1036) rlmKL 1102322..1104430 (+) 2109 WP_001086517.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  A610_RS05640 (A610_1037) uup 1104441..1106348 (+) 1908 WP_000053089.1 ABC transporter ATP-binding protein -
  A610_RS05645 (A610_1038) pqiA 1106478..1107731 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  A610_RS05650 (A610_1039) pqiB 1107736..1109376 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  A610_RS05655 (A610_1040) pqiC 1109373..1109936 (+) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  A610_RS05660 (A610_1041) rmf 1110192..1110359 (+) 168 WP_000828648.1 ribosome modulation factor -
  A610_RS05665 (A610_1042) fabA 1110429..1110947 (-) 519 WP_001386684.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  A610_RS05670 (A610_1043) ycbZ 1111016..1112776 (-) 1761 WP_000156526.1 Lon protease family protein -
  A610_RS05675 (A610_1044) matP 1112962..1113414 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  A610_RS05680 (A610_1045) ompA 1113490..1114530 (-) 1041 WP_000750416.1 porin OmpA -
  A610_RS05690 (A610_1046) sulA 1114887..1115396 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  A610_RS05695 (A610_1047) sxy/tfoX 1115615..1116244 (+) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  A610_RS05700 (A610_1048) yccS 1116207..1118369 (-) 2163 WP_000875044.1 YccS family putative transporter -
  A610_RS05705 (A610_1049) yccF 1118379..1118825 (-) 447 WP_001261231.1 YccF domain-containing protein -
  A610_RS05710 (A610_1050) helD 1118948..1121002 (+) 2055 WP_000420536.1 DNA helicase IV -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=126393 A610_RS05695 WP_000839153.1 1115615..1116244(+) (sxy/tfoX) [Escherichia coli NCCP15648]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=126393 A610_RS05695 WP_000839153.1 1115615..1116244(+) (sxy/tfoX) [Escherichia coli NCCP15648]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment