Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilV   Type   Machinery gene
Locus tag   HW00_RS06095 Genome accession   NZ_CP008867
Coordinates   1308012..1308536 (+) Length   174 a.a.
NCBI ID   WP_003116261.1    Uniprot ID   Q7WZP2
Organism   Pseudomonas aeruginosa strain T52373     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1306891..1325910 1308012..1308536 within 0


Gene organization within MGE regions


Location: 1306891..1325910
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HW00_RS06085 (HW00_06085) - 1306891..1307391 (+) 501 WP_003116259.1 GspH/FimT family pseudopilin -
  HW00_RS06090 (HW00_06090) - 1307514..1308002 (+) 489 WP_003141552.1 GspH/FimT family pseudopilin -
  HW00_RS06095 (HW00_06095) pilV 1308012..1308536 (+) 525 WP_003116261.1 type IV pilus modification protein PilV Machinery gene
  HW00_RS06100 (HW00_06100) - 1308545..1309360 (+) 816 WP_003116262.1 PilW family protein -
  HW00_RS06105 (HW00_06105) - 1309357..1309962 (+) 606 WP_003116263.1 pilus assembly PilX family protein -
  HW00_RS06110 (HW00_06110) - 1309976..1313452 (+) 3477 WP_023103514.1 pilus assembly protein -
  HW00_RS06115 (HW00_06115) - 1313455..1313781 (+) 327 WP_003116266.1 PilY2 family type 4a fimbrial biogenesis protein -
  HW00_RS06120 (HW00_06120) - 1313778..1314203 (+) 426 WP_003116267.1 type IV pilin protein -
  HW00_RS06125 (HW00_06125) ispH 1314272..1315216 (-) 945 WP_003094724.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
  HW00_RS06130 (HW00_06130) fkpB 1315302..1315742 (-) 441 WP_003102613.1 FKBP-type peptidyl-prolyl cis-trans isomerase -
  HW00_RS06135 (HW00_06135) lspA 1315735..1316244 (-) 510 WP_003102615.1 signal peptidase II -
  HW00_RS06140 (HW00_06140) ileS 1316237..1319068 (-) 2832 WP_003102617.1 isoleucine--tRNA ligase -
  HW00_RS06145 (HW00_06145) ribF 1319092..1320030 (-) 939 WP_003102619.1 bifunctional riboflavin kinase/FAD synthetase -
  HW00_RS06150 (HW00_06150) murJ 1320127..1321665 (-) 1539 WP_003102622.1 murein biosynthesis integral membrane protein MurJ -
  HW00_RS06155 (HW00_06155) rpsT 1321949..1322224 (+) 276 WP_003094744.1 30S ribosomal protein S20 -
  HW00_RS06160 (HW00_06160) - 1322291..1322755 (-) 465 WP_003094746.1 CreA family protein -
  HW00_RS06165 (HW00_06165) proB 1322767..1323885 (-) 1119 WP_003094756.1 glutamate 5-kinase -
  HW00_RS06170 (HW00_06170) cgtA 1323956..1325176 (-) 1221 WP_003094758.1 Obg family GTPase CgtA -
  HW00_RS06175 (HW00_06175) rpmA 1325318..1325575 (-) 258 WP_003094760.1 50S ribosomal protein L27 -
  HW00_RS06180 (HW00_06180) rplU 1325599..1325910 (-) 312 WP_003094761.1 50S ribosomal protein L21 -

Sequence


Protein


Download         Length: 174 a.a.        Molecular weight: 18763.51 Da        Isoelectric Point: 4.9113

>NTDB_id=125126 HW00_RS06095 WP_003116261.1 1308012..1308536(+) (pilV) [Pseudomonas aeruginosa strain T52373]
MSRETGFSMIEVLVALVLISIGVLGMVAMQGRTIQYTQESVQRNAAAMLASDLMEIMRADPDAVLNLRAQLREDSVYYKA
KGSDFPAAPARCAPLPADAKERLGCWAQQASKDLPGASALLNSQFYICRSPTPGTCDNTKGSAIEIQVAWRAMDGACFNA
SDSTLCTYSVRSEL

Nucleotide


Download         Length: 525 bp        

>NTDB_id=125126 HW00_RS06095 WP_003116261.1 1308012..1308536(+) (pilV) [Pseudomonas aeruginosa strain T52373]
ATGTCTCGAGAAACGGGTTTCAGCATGATCGAAGTACTGGTTGCTCTGGTGCTGATCAGCATTGGCGTACTGGGCATGGT
TGCCATGCAAGGGCGCACGATCCAGTACACGCAGGAGTCGGTACAACGCAATGCCGCAGCAATGCTTGCTAGCGACCTGA
TGGAAATAATGCGTGCGGACCCAGATGCCGTACTCAATCTACGCGCCCAACTACGCGAAGACTCGGTCTACTACAAGGCC
AAGGGCAGCGACTTTCCCGCAGCCCCAGCGCGCTGCGCGCCATTGCCAGCAGATGCTAAGGAACGTCTCGGCTGCTGGGC
CCAACAGGCCTCGAAAGACTTGCCGGGAGCCTCCGCACTCTTGAATAGCCAATTCTACATTTGTCGCAGCCCAACCCCGG
GTACCTGCGACAACACCAAAGGCTCGGCCATCGAAATCCAGGTTGCCTGGCGAGCCATGGATGGAGCGTGTTTCAACGCC
TCTGACTCCACCTTGTGCACCTACAGCGTCCGCTCCGAATTGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q7WZP2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilV Pseudomonas aeruginosa PAK

59.429

100

0.598


Multiple sequence alignment