Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SXYLSMQ121_RS06425 | Genome accession | NZ_CP008724 |
| Coordinates | 1365896..1366213 (+) | Length | 105 a.a. |
| NCBI ID | WP_029377192.1 | Uniprot ID | - |
| Organism | Staphylococcus xylosus strain SMQ-121 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1360896..1371213
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SXYLSMQ121_RS06395 (SXYLSMQ121_1244) | - | 1361246..1361440 (+) | 195 | WP_042363548.1 | YqgQ family protein | - |
| SXYLSMQ121_RS06400 (SXYLSMQ121_1245) | - | 1361830..1362816 (+) | 987 | WP_042362615.1 | glucokinase | - |
| SXYLSMQ121_RS06405 (SXYLSMQ121_1246) | - | 1362816..1363139 (+) | 324 | WP_042362616.1 | MTH1187 family thiamine-binding protein | - |
| SXYLSMQ121_RS06410 (SXYLSMQ121_1247) | - | 1363141..1363764 (+) | 624 | WP_042362617.1 | MBL fold metallo-hydrolase | - |
| SXYLSMQ121_RS06415 (SXYLSMQ121_1248) | comGA | 1363863..1364837 (+) | 975 | WP_042362618.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SXYLSMQ121_RS06420 (SXYLSMQ121_1249) | comGB | 1364809..1365876 (+) | 1068 | WP_042362619.1 | competence type IV pilus assembly protein ComGB | - |
| SXYLSMQ121_RS06425 | comGC | 1365896..1366213 (+) | 318 | WP_029377192.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SXYLSMQ121_RS06430 | comGD | 1366191..1366637 (+) | 447 | WP_244147591.1 | competence type IV pilus minor pilin ComGD | - |
| SXYLSMQ121_RS06435 | - | 1366624..1366923 (+) | 300 | WP_042362621.1 | hypothetical protein | - |
| SXYLSMQ121_RS06440 (SXYLSMQ121_1251) | comGF | 1366895..1367338 (+) | 444 | WP_042362622.1 | competence type IV pilus minor pilin ComGF | - |
| SXYLSMQ121_RS06450 (SXYLSMQ121_1253) | - | 1367518..1368018 (+) | 501 | WP_042363549.1 | shikimate kinase | - |
| SXYLSMQ121_RS06455 (SXYLSMQ121_1254) | gcvT | 1368206..1369297 (+) | 1092 | WP_042362624.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SXYLSMQ121_RS06460 (SXYLSMQ121_1255) | gcvPA | 1369315..1370667 (+) | 1353 | WP_042362625.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 105 a.a. Molecular weight: 11788.86 Da Isoelectric Point: 8.4952
>NTDB_id=123886 SXYLSMQ121_RS06425 WP_029377192.1 1365896..1366213(+) (comGC) [Staphylococcus xylosus strain SMQ-121]
MNNFKNKFNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQTTSCEAQLKMVDSQIEAYSLKFNKKPTTMDELVNEG
YIKENQKQCKSGALISINDGEAVAN
MNNFKNKFNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQTTSCEAQLKMVDSQIEAYSLKFNKKPTTMDELVNEG
YIKENQKQCKSGALISINDGEAVAN
Nucleotide
Download Length: 318 bp
>NTDB_id=123886 SXYLSMQ121_RS06425 WP_029377192.1 1365896..1366213(+) (comGC) [Staphylococcus xylosus strain SMQ-121]
ATGAATAATTTTAAAAATAAGTTTAACAAAAAGGCATTTACACTCATTGAAATGCTATTGGTTTTACTAATAATAAGTTT
GTTATTAATACTAATAATACCTAATATAGCTAAACAATCCTCACACATACAAACAACTAGTTGTGAAGCGCAACTCAAAA
TGGTAGATAGTCAAATTGAAGCTTATAGCTTGAAGTTCAATAAGAAGCCAACTACTATGGATGAACTCGTCAACGAAGGT
TATATCAAAGAGAACCAAAAACAATGCAAGTCAGGCGCCTTAATATCTATAAATGATGGTGAAGCAGTTGCAAATTAA
ATGAATAATTTTAAAAATAAGTTTAACAAAAAGGCATTTACACTCATTGAAATGCTATTGGTTTTACTAATAATAAGTTT
GTTATTAATACTAATAATACCTAATATAGCTAAACAATCCTCACACATACAAACAACTAGTTGTGAAGCGCAACTCAAAA
TGGTAGATAGTCAAATTGAAGCTTATAGCTTGAAGTTCAATAAGAAGCCAACTACTATGGATGAACTCGTCAACGAAGGT
TATATCAAAGAGAACCAAAAACAATGCAAGTCAGGCGCCTTAATATCTATAAATGATGGTGAAGCAGTTGCAAATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
70.297 |
96.19 |
0.676 |
| comGC | Staphylococcus aureus MW2 |
70.297 |
96.19 |
0.676 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
46.296 |
100 |
0.476 |
| comGC/cglC | Streptococcus pneumoniae D39 |
39.623 |
100 |
0.4 |
| comGC/cglC | Streptococcus pneumoniae R6 |
39.623 |
100 |
0.4 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
39.623 |
100 |
0.4 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
39.623 |
100 |
0.4 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
40 |
100 |
0.4 |
| comGC/cglC | Streptococcus mitis SK321 |
41.667 |
91.429 |
0.381 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.489 |
89.524 |
0.371 |
| comYC | Streptococcus mutans UA140 |
49.351 |
73.333 |
0.362 |
| comYC | Streptococcus mutans UA159 |
49.351 |
73.333 |
0.362 |