Detailed information
Bioinformatically predicted
Overview
| Name | HI0659 | Type | Machinery gene |
| Locus tag | SFBMNL_RS07380 | Genome accession | NZ_CP008713 |
| Coordinates | 1537297..1537533 (+) | Length | 78 a.a. |
| NCBI ID | WP_042295315.1 | Uniprot ID | - |
| Organism | Candidatus Arthromitus sp. SFB-mouse-NL | ||
| Function | DNA uptake (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1525022..1569868 | 1537297..1537533 | within | 0 |
Gene organization within MGE regions
Location: 1525022..1569868
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SFBMNL_RS07295 (SFBmNL_01498) | - | 1525022..1525954 (+) | 933 | WP_042295060.1 | magnesium transporter CorA family protein | - |
| SFBMNL_RS07300 (SFBmNL_01499) | - | 1525996..1526928 (+) | 933 | WP_242838753.1 | LD-carboxypeptidase | - |
| SFBMNL_RS07305 (SFBmNL_01500) | - | 1526993..1527871 (-) | 879 | WP_042295064.1 | hypothetical protein | - |
| SFBMNL_RS07310 (SFBmNL_01501) | - | 1528105..1528911 (+) | 807 | WP_042295066.1 | hypothetical protein | - |
| SFBMNL_RS07315 (SFBmNL_01502) | - | 1529003..1529563 (+) | 561 | WP_042295068.1 | hypothetical protein | - |
| SFBMNL_RS07320 (SFBmNL_01503) | - | 1529563..1529745 (+) | 183 | WP_042295069.1 | hypothetical protein | - |
| SFBMNL_RS07325 (SFBmNL_01504) | - | 1529770..1530171 (+) | 402 | WP_042295072.1 | hypothetical protein | - |
| SFBMNL_RS08335 (SFBmNL_01505) | - | 1530177..1530347 (+) | 171 | WP_158336027.1 | hypothetical protein | - |
| SFBMNL_RS07330 (SFBmNL_01506) | - | 1530363..1530593 (+) | 231 | WP_042295074.1 | hypothetical protein | - |
| SFBMNL_RS07335 (SFBmNL_01507) | - | 1530624..1530935 (+) | 312 | WP_042295076.1 | hypothetical protein | - |
| SFBMNL_RS07340 (SFBmNL_01508) | - | 1530954..1531301 (+) | 348 | WP_042295077.1 | hypothetical protein | - |
| SFBMNL_RS07345 (SFBmNL_01509) | - | 1531382..1532569 (+) | 1188 | WP_042295079.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SFBMNL_RS07350 (SFBmNL_01510) | - | 1532660..1533124 (-) | 465 | WP_042295082.1 | helix-turn-helix transcriptional regulator | - |
| SFBMNL_RS07355 (SFBmNL_01511) | - | 1533504..1534733 (+) | 1230 | WP_042295085.1 | viroplasmin family protein | - |
| SFBMNL_RS07360 (SFBmNL_01512) | - | 1534934..1535296 (+) | 363 | WP_042295086.1 | type II toxin-antitoxin system RnlB family antitoxin | - |
| SFBMNL_RS08555 | - | 1535297..1535467 (-) | 171 | WP_081832590.1 | DUF4214 domain-containing protein | - |
| SFBMNL_RS07365 (SFBmNL_01513) | - | 1535500..1535946 (-) | 447 | WP_052341899.1 | Panacea domain-containing protein | - |
| SFBMNL_RS08235 | - | 1536155..1536364 (-) | 210 | Protein_1461 | N-acetylmuramoyl-L-alanine amidase | - |
| SFBMNL_RS07370 (SFBmNL_01514) | - | 1536740..1536991 (+) | 252 | WP_042295088.1 | DUF4160 domain-containing protein | - |
| SFBMNL_RS07375 (SFBmNL_01515) | - | 1537032..1537289 (+) | 258 | WP_042295090.1 | DUF2442 domain-containing protein | - |
| SFBMNL_RS07380 (SFBmNL_01516) | HI0659 | 1537297..1537533 (+) | 237 | WP_042295315.1 | helix-turn-helix domain-containing protein | Machinery gene |
| SFBMNL_RS07385 (SFBmNL_01517) | - | 1537539..1537787 (+) | 249 | WP_042295093.1 | DUF4160 domain-containing protein | - |
| SFBMNL_RS07390 (SFBmNL_01518) | - | 1537831..1538496 (-) | 666 | WP_042295318.1 | N-acetylmuramoyl-L-alanine amidase | - |
| SFBMNL_RS07395 (SFBmNL_01519) | - | 1538602..1539033 (-) | 432 | WP_042295094.1 | holin family protein | - |
| SFBMNL_RS07400 (SFBmNL_01520) | - | 1539223..1540935 (-) | 1713 | WP_042294070.1 | phage tail protein | - |
| SFBMNL_RS07405 (SFBmNL_01521) | - | 1540935..1541780 (-) | 846 | WP_042295096.1 | hypothetical protein | - |
| SFBMNL_RS07410 (SFBmNL_01522) | - | 1541785..1542549 (-) | 765 | WP_042294066.1 | hypothetical protein | - |
| SFBMNL_RS07415 (SFBmNL_01523) | - | 1542536..1543252 (-) | 717 | WP_042294063.1 | phage tail protein | - |
| SFBMNL_RS07420 (SFBmNL_01524) | - | 1543249..1544340 (-) | 1092 | WP_052341885.1 | baseplate J/gp47 family protein | - |
| SFBMNL_RS07425 (SFBmNL_01525) | - | 1544342..1544620 (-) | 279 | WP_042294060.1 | hypothetical protein | - |
| SFBMNL_RS07430 (SFBmNL_01526) | - | 1544625..1545077 (-) | 453 | WP_042294057.1 | phage tail protein | - |
| SFBMNL_RS07435 (SFBmNL_01527) | - | 1545067..1545273 (-) | 207 | WP_042294055.1 | hypothetical protein | - |
| SFBMNL_RS07440 (SFBmNL_01528) | - | 1545273..1546196 (-) | 924 | WP_042294052.1 | phage late control D family protein | - |
| SFBMNL_RS07445 (SFBmNL_01529) | - | 1546199..1546456 (-) | 258 | WP_052341884.1 | hypothetical protein | - |
| SFBMNL_RS07450 (SFBmNL_01530) | - | 1546446..1549412 (-) | 2967 | WP_042295098.1 | phage tail tape measure protein | - |
| SFBMNL_RS07455 (SFBmNL_01531) | - | 1549740..1550072 (-) | 333 | WP_042294048.1 | hypothetical protein | - |
| SFBMNL_RS07460 (SFBmNL_01532) | - | 1550069..1550449 (-) | 381 | WP_042294046.1 | hypothetical protein | - |
| SFBMNL_RS07465 (SFBmNL_01533) | - | 1550458..1550976 (-) | 519 | WP_042294044.1 | phage major tail tube protein | - |
| SFBMNL_RS07470 (SFBmNL_01534) | - | 1550979..1552427 (-) | 1449 | WP_042295099.1 | hypothetical protein | - |
| SFBMNL_RS07475 (SFBmNL_01535) | - | 1552438..1552971 (-) | 534 | WP_042294040.1 | hypothetical protein | - |
| SFBMNL_RS07480 (SFBmNL_01536) | - | 1552981..1554720 (-) | 1740 | WP_042294038.1 | DUF2326 domain-containing protein | - |
| SFBMNL_RS07485 (SFBmNL_01537) | - | 1554708..1554953 (-) | 246 | WP_042294036.1 | ABC-three component system middle component 6 | - |
| SFBMNL_RS08105 (SFBmNL_01538) | - | 1554937..1555860 (-) | 924 | WP_052341883.1 | ABC-three component system protein | - |
| SFBMNL_RS07495 (SFBmNL_01539) | - | 1556007..1556333 (-) | 327 | WP_042294034.1 | hypothetical protein | - |
| SFBMNL_RS07500 (SFBmNL_01540) | - | 1556326..1556898 (-) | 573 | WP_042295101.1 | phage tail protein | - |
| SFBMNL_RS07505 (SFBmNL_01541) | - | 1556898..1557143 (-) | 246 | WP_042295103.1 | hypothetical protein | - |
| SFBMNL_RS07510 (SFBmNL_01542) | - | 1557144..1558274 (-) | 1131 | WP_042295104.1 | major capsid protein | - |
| SFBMNL_RS07515 (SFBmNL_01543) | - | 1558277..1558639 (-) | 363 | WP_052341882.1 | head decoration protein | - |
| SFBMNL_RS08110 (SFBmNL_01544) | - | 1558639..1559637 (-) | 999 | WP_052341881.1 | head maturation protease, ClpP-related | - |
| SFBMNL_RS07525 (SFBmNL_01545) | - | 1559638..1561191 (-) | 1554 | WP_042294026.1 | phage portal protein | - |
| SFBMNL_RS07530 (SFBmNL_01546) | - | 1561200..1561448 (-) | 249 | WP_242838792.1 | DUF6148 family protein | - |
| SFBMNL_RS07535 (SFBmNL_01547) | - | 1561445..1563223 (-) | 1779 | WP_052341879.1 | phage terminase large subunit family protein | - |
| SFBMNL_RS07540 (SFBmNL_01548) | - | 1563216..1563695 (-) | 480 | WP_042294023.1 | hypothetical protein | - |
| SFBMNL_RS07545 (SFBmNL_01549) | - | 1564126..1564392 (-) | 267 | WP_052341900.1 | helix-turn-helix domain-containing protein | - |
| SFBMNL_RS07550 (SFBmNL_01550) | - | 1564394..1564759 (-) | 366 | WP_042295106.1 | HNH endonuclease | - |
| SFBMNL_RS07555 (SFBmNL_01551) | - | 1564743..1564994 (-) | 252 | WP_052341901.1 | DUF3310 domain-containing protein | - |
| SFBMNL_RS07560 (SFBmNL_01552) | - | 1565063..1565509 (-) | 447 | WP_042295107.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| SFBMNL_RS07565 (SFBmNL_01553) | - | 1565642..1565839 (-) | 198 | WP_042294019.1 | type II toxin-antitoxin system HicA family toxin | - |
| SFBMNL_RS08280 (SFBmNL_01554) | - | 1565987..1566538 (-) | 552 | WP_144238983.1 | helix-turn-helix domain-containing protein | - |
| SFBMNL_RS07580 (SFBmNL_01555) | - | 1566561..1566806 (-) | 246 | WP_369751269.1 | DUF4160 domain-containing protein | - |
| SFBMNL_RS07585 (SFBmNL_01556) | - | 1567089..1567634 (-) | 546 | WP_042295112.1 | tyrosine-type recombinase/integrase | - |
| SFBMNL_RS07590 (SFBmNL_01558) | - | 1568025..1568441 (-) | 417 | WP_042295114.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| SFBMNL_RS07595 (SFBmNL_01559) | - | 1568801..1569868 (+) | 1068 | WP_042295116.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 8966.80 Da Isoelectric Point: 10.8614
>NTDB_id=123836 SFBMNL_RS07380 WP_042295315.1 1537297..1537533(+) (HI0659) [Candidatus Arthromitus sp. SFB-mouse-NL]
MIEEKIKEIVSEIIRLRRENGLTQKQLEELSNIKQPIIARMEKGTNIPQLNTILKLLKPLGKTIAIVPLEKTKPTKPR
MIEEKIKEIVSEIIRLRRENGLTQKQLEELSNIKQPIIARMEKGTNIPQLNTILKLLKPLGKTIAIVPLEKTKPTKPR
Nucleotide
Download Length: 237 bp
>NTDB_id=123836 SFBMNL_RS07380 WP_042295315.1 1537297..1537533(+) (HI0659) [Candidatus Arthromitus sp. SFB-mouse-NL]
ATGATTGAAGAAAAGATAAAAGAAATTGTATCCGAAATAATAAGACTTAGACGGGAAAATGGACTCACACAGAAACAACT
TGAAGAGTTAAGCAACATAAAACAACCAATTATAGCGAGGATGGAAAAAGGAACAAATATACCGCAACTCAACACTATTT
TAAAATTACTAAAACCTTTGGGGAAAACAATTGCAATAGTTCCTCTTGAAAAAACAAAACCAACTAAACCGAGGTGA
ATGATTGAAGAAAAGATAAAAGAAATTGTATCCGAAATAATAAGACTTAGACGGGAAAATGGACTCACACAGAAACAACT
TGAAGAGTTAAGCAACATAAAACAACCAATTATAGCGAGGATGGAAAAAGGAACAAATATACCGCAACTCAACACTATTT
TAAAATTACTAAAACCTTTGGGGAAAACAATTGCAATAGTTCCTCTTGAAAAAACAAAACCAACTAAACCGAGGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| HI0659 | Haemophilus influenzae Rd KW20 |
56.164 |
93.59 |
0.526 |