Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BSUA_RS17205 Genome accession   NZ_CP007800
Coordinates   3229859..3229999 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3224859..3234999
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSUA_RS17180 (BSUA_03386) yuxO 3225172..3225552 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  BSUA_RS17185 (BSUA_03387) comA 3225571..3226215 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSUA_RS17190 (BSUA_03388) comP 3226296..3228605 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  BSUA_RS17195 (BSUA_03389) comX 3228620..3228787 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  BSUA_RS17200 (BSUA_03390) comQ 3228775..3229674 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  BSUA_RS17205 (BSUA_03391) degQ 3229859..3229999 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSUA_RS22945 - 3230221..3230346 (+) 126 WP_003228793.1 hypothetical protein -
  BSUA_RS17210 (BSUA_03392) - 3230460..3230828 (+) 369 WP_003243784.1 hypothetical protein -
  BSUA_RS17215 (BSUA_03393) pdeH 3230804..3232033 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BSUA_RS17220 (BSUA_03394) pncB 3232170..3233642 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  BSUA_RS17225 (BSUA_03395) pncA 3233658..3234209 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  BSUA_RS17230 (BSUA_03396) yueI 3234306..3234704 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=123435 BSUA_RS17205 WP_003220708.1 3229859..3229999(-) (degQ) [Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=123435 BSUA_RS17205 WP_003220708.1 3229859..3229999(-) (degQ) [Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment