Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilH   Type   Machinery gene
Locus tag   B6116_RS06525 Genome accession   NZ_CP007667
Coordinates   1258368..1259033 (+) Length   221 a.a.
NCBI ID   WP_047957332.1    Uniprot ID   -
Organism   Neisseria meningitidis strain B6116/77     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1256653..1318354 1258368..1259033 within 0


Gene organization within MGE regions


Location: 1256653..1318354
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B6116_RS06520 (B6116_01227) dnaB 1256653..1258059 (+) 1407 WP_002227431.1 replicative DNA helicase -
  B6116_RS06525 (B6116_01228) pilH 1258368..1259033 (+) 666 WP_047957332.1 GspH/FimT family pseudopilin Machinery gene
  B6116_RS06530 (B6116_01229) pilV 1259066..1259677 (+) 612 WP_047957366.1 type IV pilus modification protein PilV Machinery gene
  B6116_RS06535 (B6116_01230) pilJ 1259674..1260654 (+) 981 WP_047957333.1 PilW family protein Machinery gene
  B6116_RS06540 (B6116_01231) pilK 1260633..1261226 (+) 594 WP_047957334.1 pilus assembly PilX family protein Machinery gene
  B6116_RS06545 (B6116_01232) pilX 1261231..1261704 (+) 474 WP_193376947.1 PilX family type IV pilin Machinery gene
  B6116_RS06555 (B6116_01233) - 1264804..1265232 (-) 429 Protein_1237 AzlC family ABC transporter permease -
  B6116_RS06560 (B6116_01234) dut 1265375..1265827 (+) 453 WP_002226436.1 dUTP diphosphatase -
  B6116_RS06565 (B6116_01235) dapC 1265903..1267090 (+) 1188 WP_002222650.1 succinyldiaminopimelate transaminase -
  B6116_RS15435 - 1267178..1267303 (+) 126 Protein_1240 IS5/IS1182 family transposase -
  B6116_RS06570 (B6116_01236) yaaA 1267352..1268131 (+) 780 WP_002220681.1 peroxide stress protein YaaA -
  B6116_RS06585 (B6116_01239) - 1268663..1269859 (+) 1197 WP_002238460.1 tyrosine-type recombinase/integrase -
  B6116_RS06590 (B6116_01240) - 1270014..1270394 (+) 381 WP_002220683.1 type II toxin-antitoxin system PemK/MazF family toxin -
  B6116_RS06605 (B6116_01241) - 1270830..1271309 (+) 480 WP_002244521.1 DUF4760 domain-containing protein -
  B6116_RS06610 (B6116_01242) - 1272177..1273094 (+) 918 WP_002220686.1 KilA-N domain-containing protein -
  B6116_RS06615 (B6116_01243) - 1273152..1273361 (-) 210 WP_002220687.1 hypothetical protein -
  B6116_RS06620 (B6116_01244) - 1273358..1273498 (-) 141 WP_002220688.1 hypothetical protein -
  B6116_RS06625 (B6116_01245) - 1273498..1273689 (-) 192 WP_002219435.1 type ISP restriction/modification enzyme -
  B6116_RS06630 (B6116_01246) - 1273692..1273985 (-) 294 WP_002220689.1 hypothetical protein -
  B6116_RS06635 (B6116_01247) - 1273982..1274242 (-) 261 WP_002220690.1 NGO1622 family putative holin -
  B6116_RS06640 (B6116_01248) - 1274278..1274493 (-) 216 WP_002220692.1 hypothetical protein -
  B6116_RS06645 (B6116_01249) - 1274565..1275419 (-) 855 WP_002220693.1 YfdQ family protein -
  B6116_RS06650 (B6116_01250) - 1275444..1275803 (-) 360 WP_002220694.1 hypothetical protein -
  B6116_RS06655 (B6116_01251) - 1275871..1276071 (-) 201 WP_002219431.1 hypothetical protein -
  B6116_RS06660 (B6116_01252) - 1276302..1276727 (-) 426 WP_002220695.1 hypothetical protein -
  B6116_RS06665 (B6116_01253) - 1276830..1277546 (-) 717 WP_002220696.1 LexA family transcriptional regulator -
  B6116_RS06670 (B6116_01254) - 1277946..1278293 (+) 348 WP_002220698.1 hypothetical protein -
  B6116_RS06675 (B6116_01255) - 1278408..1281254 (+) 2847 WP_002220699.1 primase-helicase family protein -
  B6116_RS06680 (B6116_01256) - 1281271..1281480 (+) 210 WP_002220700.1 hypothetical protein -
  B6116_RS06685 (B6116_01257) - 1281483..1281869 (+) 387 WP_002220701.1 DUF3310 domain-containing protein -
  B6116_RS06690 (B6116_01258) - 1281856..1282110 (+) 255 WP_002220702.1 hypothetical protein -
  B6116_RS06695 (B6116_01259) - 1282119..1283681 (+) 1563 WP_002220703.1 phage portal protein -
  B6116_RS06700 (B6116_01260) - 1283662..1285554 (+) 1893 WP_002220704.1 phage major capsid protein -
  B6116_RS06705 (B6116_01261) - 1285612..1285839 (+) 228 WP_002220705.1 hypothetical protein -
  B6116_RS06710 (B6116_01262) - 1285832..1286134 (+) 303 WP_002244523.1 head-tail joining protein -
  B6116_RS06715 (B6116_01263) - 1286115..1286534 (+) 420 WP_002244524.1 hypothetical protein -
  B6116_RS06720 (B6116_01264) - 1286566..1287207 (+) 642 WP_002220708.1 phage tail protein -
  B6116_RS06725 (B6116_01265) - 1287271..1287582 (+) 312 WP_002220709.1 phage tail assembly chaperone -
  B6116_RS06730 - 1287630..1287902 (+) 273 WP_002220710.1 DUF1799 domain-containing protein -
  B6116_RS06735 (B6116_01266) - 1287895..1291113 (+) 3219 WP_002224445.1 phage tail length tape measure family protein -
  B6116_RS06740 (B6116_01267) - 1291135..1291404 (+) 270 WP_002217457.1 phage tail protein -
  B6116_RS06745 (B6116_01268) - 1291464..1292186 (+) 723 WP_002217456.1 phage minor tail protein L -
  B6116_RS06750 (B6116_01269) - 1292183..1292938 (+) 756 WP_002244525.1 C40 family peptidase -
  B6116_RS06755 (B6116_01270) - 1292935..1293657 (+) 723 WP_002220716.1 tail assembly protein -
  B6116_RS06760 (B6116_01271) gpJ 1293793..1298058 (+) 4266 WP_002244526.1 TipJ family phage tail tip protein -
  B6116_RS06765 (B6116_01272) - 1298129..1298575 (+) 447 WP_002241437.1 hypothetical protein -
  B6116_RS15290 (B6116_01273) - 1298592..1298798 (+) 207 WP_002217448.1 hypothetical protein -
  B6116_RS06775 (B6116_01274) - 1298866..1299237 (+) 372 WP_002217445.1 hypothetical protein -
  B6116_RS06780 (B6116_01275) - 1299301..1299726 (+) 426 WP_002220721.1 hypothetical protein -
  B6116_RS06785 (B6116_01276) - 1299723..1299998 (+) 276 WP_002217443.1 hypothetical protein -
  B6116_RS06790 (B6116_01277) - 1300137..1300610 (+) 474 WP_002220733.1 D-Ala-D-Ala carboxypeptidase family metallohydrolase -
  B6116_RS06795 (B6116_01278) - 1300622..1301131 (+) 510 WP_002220734.1 hypothetical protein -
  B6116_RS06800 (B6116_01279) - 1301184..1301531 (-) 348 WP_002217440.1 type II toxin-antitoxin system PemK/MazF family toxin -
  B6116_RS06805 (B6116_01280) - 1301533..1301769 (-) 237 WP_002217439.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  B6116_RS06810 (B6116_01281) - 1302128..1302766 (-) 639 WP_002244527.1 DUF4760 domain-containing protein -
  B6116_RS14745 - 1302871..1303041 (-) 171 WP_164728559.1 hypothetical protein -
  B6116_RS06815 (B6116_01282) - 1303057..1303425 (-) 369 WP_002217436.1 type II toxin-antitoxin system death-on-curing family toxin -
  B6116_RS15210 (B6116_01283) - 1303422..1303553 (-) 132 WP_002217434.1 hypothetical protein -
  B6116_RS06825 (B6116_01284) - 1303969..1304963 (-) 995 Protein_1289 IS5 family transposase -
  B6116_RS06830 (B6116_01285) - 1305004..1305843 (+) 840 WP_002214477.1 hypothetical protein -
  B6116_RS06835 (B6116_01287) - 1306113..1307375 (-) 1263 WP_002214479.1 HlyD family secretion protein -
  B6116_RS06840 (B6116_01288) - 1307377..1309473 (-) 2097 WP_002244529.1 peptidase domain-containing ABC transporter -
  B6116_RS06845 - 1309690..1310025 (-) 336 WP_002214483.1 hypothetical protein -
  B6116_RS06855 - 1310618..1310953 (-) 336 WP_014574212.1 hypothetical protein -
  B6116_RS06860 (B6116_01291) - 1311195..1312343 (-) 1149 WP_025462963.1 JmjC domain-containing protein -
  B6116_RS06865 (B6116_01292) - 1312519..1312722 (-) 204 WP_002214489.1 hypothetical protein -
  B6116_RS14890 - 1312765..1313058 (-) 294 WP_002214491.1 hypothetical protein -
  B6116_RS15295 - 1313071..1313172 (-) 102 Protein_1298 peptide transporter -
  B6116_RS14895 (B6116_01293) - 1313185..1313409 (-) 225 WP_002234261.1 AAA family ATPase -
  B6116_RS06880 (B6116_01294) - 1313756..1314763 (-) 1008 WP_047957336.1 IS5 family transposase -
  B6116_RS13865 - 1314827..1314961 (-) 135 Protein_1301 IS110 family transposase -
  B6116_RS06885 (B6116_01295) - 1316129..1318354 (-) 2226 WP_002244532.1 NADP-dependent isocitrate dehydrogenase -

Sequence


Protein


Download         Length: 221 a.a.        Molecular weight: 24556.04 Da        Isoelectric Point: 9.4348

>NTDB_id=122201 B6116_RS06525 WP_047957332.1 1258368..1259033(+) (pilH) [Neisseria meningitidis strain B6116/77]
MCTRKQQGFTLTELLIVMVIAAIMAMIALPNMSQWIASRRIASHAEQVANLLRFSRGEAVRLNLPVYICPVQVKKGGAPN
NKCDFGKKGQGMLAFGDKNGNKTYDGDTADVLLRSVVLNDDINDKRINYAFNHIAFGQTQPTADRVVWTFNQNGTFGYST
NQDLTNTSRFVYSDGYIQIVLTDARAVSDADKKFRSAVVLIDSSGRVEVCPRNDRRAVCQH

Nucleotide


Download         Length: 666 bp        

>NTDB_id=122201 B6116_RS06525 WP_047957332.1 1258368..1259033(+) (pilH) [Neisseria meningitidis strain B6116/77]
ATGTGTACACGAAAACAACAAGGTTTCACGCTAACAGAGCTGCTCATCGTGATGGTCATTGCAGCCATTATGGCGATGAT
AGCCCTCCCCAATATGAGCCAATGGATTGCATCCCGCCGCATTGCCAGTCACGCGGAGCAGGTTGCCAACCTTTTGCGTT
TCTCCAGGGGAGAAGCCGTCCGGCTCAATCTTCCTGTCTATATCTGTCCTGTTCAAGTTAAAAAAGGCGGTGCGCCCAAC
AATAAATGTGACTTCGGCAAGAAGGGGCAGGGAATGTTGGCTTTTGGCGATAAGAATGGCAATAAGACATATGACGGCGA
TACGGCGGATGTTCTCCTTCGCAGTGTGGTATTGAATGATGATATCAATGATAAGCGGATTAATTATGCCTTCAACCATA
TCGCTTTTGGTCAGACTCAGCCGACCGCTGACCGTGTAGTTTGGACATTCAATCAAAACGGGACGTTCGGTTATTCTACC
AATCAGGATCTCACGAATACTTCCAGATTTGTTTACTCCGACGGTTATATCCAAATCGTGCTGACAGATGCGAGAGCAGT
TTCAGATGCCGATAAGAAATTCCGTTCGGCGGTGGTTTTGATTGACAGCAGCGGCAGGGTCGAAGTTTGCCCTAGAAACG
ATAGGCGTGCCGTATGCCAACATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilH Neisseria gonorrhoeae MS11

86.425

100

0.864


Multiple sequence alignment