Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   SD90_RS00670 Genome accession   NZ_CP010450
Coordinates   104472..104756 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain NGAS638     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99472..109756
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SD90_RS00645 (SD90_00645) - 101418..101783 (+) 366 WP_002986560.1 DUF1033 family protein -
  SD90_RS00650 (SD90_00650) comGA 101876..102814 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  SD90_RS00655 (SD90_00655) comGB 102750..103784 (+) 1035 WP_225793059.1 competence type IV pilus assembly protein ComGB Machinery gene
  SD90_RS00660 (SD90_00660) comGC 103786..104112 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  SD90_RS00665 (SD90_00665) comGD 104087..104515 (+) 429 WP_023605232.1 competence type IV pilus minor pilin ComGD Machinery gene
  SD90_RS00670 (SD90_00670) comGE 104472..104756 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  SD90_RS00675 (SD90_00675) comGF 104749..105183 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  SD90_RS00680 (SD90_00680) comGG 105167..105493 (+) 327 WP_002992739.1 competence type IV pilus minor pilin ComGG -
  SD90_RS00685 (SD90_00685) comGH 105591..106544 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  SD90_RS00690 (SD90_00690) - 106603..107799 (+) 1197 WP_032463122.1 acetate kinase -
  SD90_RS00695 (SD90_00695) - 107985..108293 (+) 309 WP_032463123.1 hypothetical protein -
  SD90_RS00700 (SD90_00700) proC 108376..109146 (-) 771 WP_002992745.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=121354 SD90_RS00670 WP_011284422.1 104472..104756(+) (comGE) [Streptococcus pyogenes strain NGAS638]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=121354 SD90_RS00670 WP_011284422.1 104472..104756(+) (comGE) [Streptococcus pyogenes strain NGAS638]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTTGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment