Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   RP72_RS13315 Genome accession   NZ_CP010314
Coordinates   2531938..2532111 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2526938..2537111
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RP72_RS13300 (RP72_13300) gcvT 2527737..2528825 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  RP72_RS13305 (RP72_13305) hepAA 2529267..2530940 (+) 1674 WP_004398544.1 SNF2-related protein -
  RP72_RS13310 (RP72_13310) yqhG 2530961..2531755 (+) 795 WP_003230200.1 YqhG family protein -
  RP72_RS13315 (RP72_13315) sinI 2531938..2532111 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  RP72_RS13320 (RP72_13320) sinR 2532145..2532480 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RP72_RS13325 (RP72_13325) tasA 2532573..2533358 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  RP72_RS13330 (RP72_13330) sipW 2533422..2533994 (-) 573 WP_003246088.1 signal peptidase I SipW -
  RP72_RS13335 (RP72_13335) tapA 2533978..2534739 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  RP72_RS13340 (RP72_13340) yqzG 2535011..2535337 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RP72_RS13345 (RP72_13345) spoIITA 2535379..2535558 (-) 180 WP_003230176.1 YqzE family protein -
  RP72_RS13350 (RP72_13350) comGG 2535629..2536003 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  RP72_RS13355 (RP72_13355) comGF 2536004..2536387 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  RP72_RS13360 (RP72_13360) comGE 2536413..2536760 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=119876 RP72_RS13315 WP_003230187.1 2531938..2532111(+) (sinI) [Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=119876 RP72_RS13315 WP_003230187.1 2531938..2532111(+) (sinI) [Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1