Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KHU1_RS10605 | Genome accession | NZ_CP007242 |
| Coordinates | 2271148..2271321 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens KHG19 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2266148..2276321
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KHU1_RS10590 (KHU1_2076) | gcvT | 2266961..2268061 (-) | 1101 | WP_042635355.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KHU1_RS10595 (KHU1_2077) | - | 2268485..2270155 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| KHU1_RS10600 (KHU1_2078) | - | 2270177..2270971 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| KHU1_RS10605 (KHU1_2079) | sinI | 2271148..2271321 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| KHU1_RS10610 (KHU1_2080) | sinR | 2271355..2271690 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| KHU1_RS10615 (KHU1_2081) | tasA | 2271738..2272523 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| KHU1_RS10620 (KHU1_2082) | sipW | 2272588..2273172 (-) | 585 | WP_007408328.1 | signal peptidase I SipW | - |
| KHU1_RS10625 (KHU1_2083) | tapA | 2273144..2273815 (-) | 672 | WP_042635356.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KHU1_RS10630 (KHU1_2084) | - | 2274074..2274403 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| KHU1_RS10635 (KHU1_2085) | - | 2274443..2274622 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| KHU1_RS10640 (KHU1_2086) | comGG | 2274679..2275056 (-) | 378 | WP_032866434.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KHU1_RS10645 (KHU1_2087) | comGF | 2275057..2275557 (-) | 501 | WP_262982688.1 | competence type IV pilus minor pilin ComGF | - |
| KHU1_RS10650 (KHU1_2088) | comGE | 2275466..2275780 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| KHU1_RS10655 (KHU1_2089) | comGD | 2275764..2276201 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=118144 KHU1_RS10605 WP_003153105.1 2271148..2271321(+) (sinI) [Bacillus amyloliquefaciens KHG19]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=118144 KHU1_RS10605 WP_003153105.1 2271148..2271321(+) (sinI) [Bacillus amyloliquefaciens KHG19]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |