Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KHU1_RS10605 Genome accession   NZ_CP007242
Coordinates   2271148..2271321 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens KHG19     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2266148..2276321
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHU1_RS10590 (KHU1_2076) gcvT 2266961..2268061 (-) 1101 WP_042635355.1 glycine cleavage system aminomethyltransferase GcvT -
  KHU1_RS10595 (KHU1_2077) - 2268485..2270155 (+) 1671 WP_031378948.1 DEAD/DEAH box helicase -
  KHU1_RS10600 (KHU1_2078) - 2270177..2270971 (+) 795 WP_007408330.1 YqhG family protein -
  KHU1_RS10605 (KHU1_2079) sinI 2271148..2271321 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KHU1_RS10610 (KHU1_2080) sinR 2271355..2271690 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KHU1_RS10615 (KHU1_2081) tasA 2271738..2272523 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KHU1_RS10620 (KHU1_2082) sipW 2272588..2273172 (-) 585 WP_007408328.1 signal peptidase I SipW -
  KHU1_RS10625 (KHU1_2083) tapA 2273144..2273815 (-) 672 WP_042635356.1 amyloid fiber anchoring/assembly protein TapA -
  KHU1_RS10630 (KHU1_2084) - 2274074..2274403 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  KHU1_RS10635 (KHU1_2085) - 2274443..2274622 (-) 180 WP_003153093.1 YqzE family protein -
  KHU1_RS10640 (KHU1_2086) comGG 2274679..2275056 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  KHU1_RS10645 (KHU1_2087) comGF 2275057..2275557 (-) 501 WP_262982688.1 competence type IV pilus minor pilin ComGF -
  KHU1_RS10650 (KHU1_2088) comGE 2275466..2275780 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  KHU1_RS10655 (KHU1_2089) comGD 2275764..2276201 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=118144 KHU1_RS10605 WP_003153105.1 2271148..2271321(+) (sinI) [Bacillus amyloliquefaciens KHG19]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=118144 KHU1_RS10605 WP_003153105.1 2271148..2271321(+) (sinI) [Bacillus amyloliquefaciens KHG19]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment