Detailed information    

insolico Bioinformatically predicted

Overview


Name   ctsT   Type   Machinery gene
Locus tag   AD53_RS05865 Genome accession   NZ_CP007188
Coordinates   1088638..1088940 (+) Length   100 a.a.
NCBI ID   WP_002853046.1    Uniprot ID   Q0P9H7
Organism   Campylobacter jejuni strain HF5-4A-4     
Function   type II secretion system/type IV pilin; DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1083439..1128835 1088638..1088940 within 0


Gene organization within MGE regions


Location: 1083439..1128835
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AD53_RS05835 (AD53_05865) ssb 1083439..1083990 (+) 552 WP_002853013.1 single-stranded DNA-binding protein -
  AD53_RS05840 (AD53_05870) rpsR 1084001..1084261 (+) 261 WP_002853032.1 30S ribosomal protein S18 -
  AD53_RS05845 (AD53_05875) lon 1084321..1086696 (-) 2376 WP_002885146.1 endopeptidase La -
  AD53_RS05850 (AD53_05880) - 1086713..1087360 (-) 648 WP_002852961.1 outer membrane protein assembly factor BamD -
  AD53_RS05855 (AD53_05885) fliW 1087521..1087910 (+) 390 WP_002852982.1 flagellar assembly protein FliW -
  AD53_RS05860 (AD53_05890) proC 1087910..1088641 (+) 732 WP_002858388.1 pyrroline-5-carboxylate reductase Machinery gene
  AD53_RS05865 (AD53_05895) ctsT 1088638..1088940 (+) 303 WP_002853046.1 type II secretion system protein Machinery gene
  AD53_RS05870 (AD53_05900) - 1088937..1089119 (+) 183 Protein_1137 hypothetical protein -
  AD53_RS05875 (AD53_05905) - 1089215..1089913 (-) 699 WP_041016326.1 hypothetical protein -
  AD53_RS05880 (AD53_05910) - 1089913..1090587 (-) 675 WP_032584112.1 LexA family transcriptional regulator -
  AD53_RS05885 (AD53_05915) - 1090737..1090937 (+) 201 WP_002804142.1 hypothetical protein -
  AD53_RS05890 (AD53_05920) - 1090934..1093010 (+) 2077 Protein_1141 DDE-type integrase/transposase/recombinase -
  AD53_RS05895 (AD53_05925) - 1093081..1094004 (+) 924 WP_002806833.1 AAA family ATPase -
  AD53_RS05900 (AD53_05930) - 1094007..1094198 (+) 192 WP_002795448.1 sigma factor-like helix-turn-helix DNA-binding protein -
  AD53_RS05905 (AD53_05935) - 1094195..1094380 (+) 186 WP_002824157.1 hypothetical protein -
  AD53_RS05910 (AD53_05940) - 1094514..1094855 (+) 342 WP_002791419.1 DUF4406 domain-containing protein -
  AD53_RS05915 (AD53_05945) - 1094962..1095447 (+) 486 WP_075912952.1 host-nuclease inhibitor Gam family protein -
  AD53_RS05920 (AD53_05950) - 1095506..1096468 (+) 963 WP_052834668.1 hypothetical protein -
  AD53_RS05925 (AD53_05955) - 1096465..1096734 (+) 270 WP_002784531.1 hypothetical protein -
  AD53_RS05930 (AD53_05960) - 1096734..1097426 (+) 693 WP_002793908.1 hypothetical protein -
  AD53_RS05935 (AD53_05965) - 1097423..1097872 (+) 450 WP_002876315.1 regulatory protein GemA -
  AD53_RS05940 (AD53_05970) - 1097919..1098194 (+) 276 WP_002784526.1 hypothetical protein -
  AD53_RS05945 (AD53_05975) - 1098186..1098856 (-) 671 Protein_1152 endonuclease -
  AD53_RS05950 (AD53_05980) - 1098950..1099234 (+) 285 WP_002784523.1 Mor transcription activator family protein -
  AD53_RS05955 (AD53_05985) - 1099231..1100208 (-) 978 WP_002852060.1 tail protein -
  AD53_RS05960 (AD53_05990) - 1100202..1100393 (-) 192 WP_002784520.1 tail protein X -
  AD53_RS05965 (AD53_05995) - 1100386..1100760 (-) 375 WP_052834669.1 phage tail protein -
  AD53_RS05970 (AD53_06000) - 1100892..1102130 (-) 1239 WP_052834670.1 phage minor head protein -
  AD53_RS05975 (AD53_06005) - 1102133..1103503 (-) 1371 WP_002809611.1 DUF935 family protein -
  AD53_RS05980 (AD53_06010) terL 1103513..1105183 (-) 1671 WP_002865471.1 phage terminase large subunit -
  AD53_RS05985 (AD53_06015) - 1105183..1105782 (-) 600 WP_002803360.1 DUF1804 family protein -
  AD53_RS05990 (AD53_06020) - 1105775..1106233 (-) 459 WP_002855185.1 phage protein Gp36 family protein -
  AD53_RS05995 (AD53_06025) - 1106349..1107326 (-) 978 WP_032584092.1 major capsid protein -
  AD53_RS06000 (AD53_06030) - 1107329..1107856 (-) 528 WP_032584089.1 hypothetical protein -
  AD53_RS06005 (AD53_06035) - 1107859..1108674 (-) 816 WP_002901531.1 phage protease -
  AD53_RS06010 (AD53_06040) - 1108676..1109110 (-) 435 WP_002784501.1 hypothetical protein -
  AD53_RS06015 (AD53_06045) - 1109259..1109648 (+) 390 WP_075912925.1 D-Ala-D-Ala carboxypeptidase family metallohydrolase -
  AD53_RS06020 (AD53_06050) - 1109659..1110000 (+) 342 WP_002827119.1 hypothetical protein -
  AD53_RS06025 (AD53_06055) - 1109997..1110245 (+) 249 WP_002784496.1 hypothetical protein -
  AD53_RS06030 (AD53_06065) - 1110357..1110671 (+) 315 WP_002784492.1 phage holin family protein -
  AD53_RS06035 (AD53_06070) - 1110671..1111303 (+) 633 WP_002876443.1 phage baseplate assembly protein V -
  AD53_RS06040 (AD53_06075) - 1111312..1111503 (+) 192 WP_002795238.1 hypothetical protein -
  AD53_RS06045 (AD53_06080) - 1111500..1111790 (+) 291 WP_002795239.1 GPW/gp25 family protein -
  AD53_RS06050 (AD53_06085) - 1111787..1112953 (+) 1167 WP_032584246.1 baseplate J/gp47 family protein -
  AD53_RS06055 (AD53_06090) - 1112950..1113570 (+) 621 WP_043012798.1 phage tail protein I -
  AD53_RS10355 (AD53_06095) - 1113570..1114535 (+) 966 WP_042963348.1 phage tail protein -
  AD53_RS06065 (AD53_06100) - 1114560..1115066 (+) 507 WP_002924980.1 DUF4376 domain-containing protein -
  AD53_RS06070 (AD53_06105) - 1115063..1115434 (+) 372 WP_042963349.1 DUF1353 domain-containing protein -
  AD53_RS06075 (AD53_06110) - 1115558..1116565 (+) 1008 WP_002922154.1 hypothetical protein -
  AD53_RS06080 (AD53_06115) - 1116584..1117774 (+) 1191 WP_075912953.1 phage tail protein -
  AD53_RS06085 (AD53_06120) - 1117897..1118412 (+) 516 WP_002865794.1 phage major tail tube protein -
  AD53_RS06090 (AD53_06125) - 1118423..1118659 (+) 237 WP_002789979.1 phage tail assembly protein -
  AD53_RS10085 - 1118643..1118780 (+) 138 WP_172670202.1 hypothetical protein -
  AD53_RS06095 (AD53_06130) - 1118767..1118997 (-) 231 WP_002870149.1 hypothetical protein -
  AD53_RS06100 (AD53_06135) - 1119027..1120991 (+) 1965 WP_044261143.1 phage tail tape measure protein -
  AD53_RS06105 (AD53_06140) - 1120993..1121367 (+) 375 WP_002789966.1 phage tail protein -
  AD53_RS06110 (AD53_06145) - 1121360..1121551 (+) 192 WP_002789964.1 tail protein X -
  AD53_RS06115 (AD53_06150) - 1121545..1122513 (+) 969 WP_002865687.1 phage tail protein -
  AD53_RS06120 (AD53_06155) - 1122615..1123430 (+) 816 WP_075912954.1 DNA adenine methylase -
  AD53_RS06125 (AD53_06160) - 1123460..1123747 (-) 288 WP_075912922.1 hypothetical protein -
  AD53_RS06130 (AD53_06165) - 1123827..1124021 (-) 195 WP_002843339.1 hypothetical protein -
  AD53_RS06135 (AD53_06170) - 1124031..1124351 (-) 321 WP_002865000.1 hypothetical protein -
  AD53_RS06140 (AD53_06175) - 1124432..1125061 (-) 630 WP_032582421.1 LexA family transcriptional regulator -
  AD53_RS06145 (AD53_06180) - 1125141..1126829 (-) 1689 WP_075912921.1 P-loop NTPase fold protein -
  AD53_RS06155 (AD53_06185) - 1127272..1127760 (+) 489 Protein_1194 hypothetical protein -
  AD53_RS06160 (AD53_06190) - 1127757..1128209 (+) 453 WP_002859148.1 hypothetical protein -
  AD53_RS06165 (AD53_06195) hemD 1128206..1128835 (-) 630 WP_002858312.1 uroporphyrinogen-III synthase -

Sequence


Protein


Download         Length: 100 a.a.        Molecular weight: 12162.27 Da        Isoelectric Point: 6.2957

>NTDB_id=117233 AD53_RS05865 WP_002853046.1 1088638..1088940(+) (ctsT) [Campylobacter jejuni strain HF5-4A-4]
MKKAFILIESISAITIISLIFIGIFYYYIQLYKNYENLNIFERLYKLQEELYEKPIFKTIILQTSALKPIVLQEQFVNDG
IFQFQKLYFQDQNYSVYFKE

Nucleotide


Download         Length: 303 bp        

>NTDB_id=117233 AD53_RS05865 WP_002853046.1 1088638..1088940(+) (ctsT) [Campylobacter jejuni strain HF5-4A-4]
ATGAAAAAGGCTTTCATACTTATAGAAAGCATTAGTGCTATAACGATCATATCTTTAATTTTCATTGGCATTTTTTATTA
CTATATTCAACTTTACAAAAACTATGAAAATTTAAATATTTTTGAAAGACTCTATAAACTTCAAGAAGAATTATATGAAA
AGCCTATTTTTAAAACCATCATACTTCAAACTTCAGCCTTAAAACCTATAGTTTTACAAGAACAGTTTGTTAATGACGGT
ATATTTCAATTTCAAAAATTATACTTTCAAGATCAAAATTATAGCGTTTATTTTAAAGAATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q0P9H7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ctsT Campylobacter jejuni subsp. jejuni 81-176

99

100

0.99


Multiple sequence alignment