Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | AW02_RS15170 | Genome accession | NZ_CP007165 |
| Coordinates | 3154550..3154690 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis NJN-6 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3149550..3159690
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AW02_RS15130 (AW02_029900) | - | 3149728..3150204 (+) | 477 | WP_003152059.1 | Na+/H+ antiporter subunit E | - |
| AW02_RS15135 (AW02_029910) | - | 3150204..3150488 (+) | 285 | WP_003152057.1 | Na(+)/H(+) antiporter subunit F1 | - |
| AW02_RS15140 (AW02_029920) | mnhG | 3150472..3150846 (+) | 375 | WP_003152056.1 | monovalent cation/H(+) antiporter subunit G | - |
| AW02_RS15145 (AW02_029930) | - | 3150886..3151269 (-) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
| AW02_RS15150 (AW02_029940) | comA | 3151291..3151935 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| AW02_RS15155 (AW02_029950) | - | 3152016..3153191 (-) | 1176 | Protein_3015 | sensor histidine kinase | - |
| AW02_RS15160 (AW02_029960) | comX | 3153323..3153487 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| AW02_RS15165 (AW02_029970) | - | 3153487..3154398 (-) | 912 | WP_014305720.1 | polyprenyl synthetase family protein | - |
| AW02_RS15170 (AW02_029980) | degQ | 3154550..3154690 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| AW02_RS15175 (AW02_030000) | - | 3155156..3155497 (+) | 342 | WP_014305721.1 | hypothetical protein | - |
| AW02_RS15180 (AW02_030010) | - | 3155504..3156724 (-) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| AW02_RS15185 (AW02_030020) | - | 3156854..3158320 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| AW02_RS15190 (AW02_030030) | - | 3158338..3158889 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| AW02_RS15195 (AW02_030040) | - | 3158986..3159384 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=116733 AW02_RS15170 WP_003152043.1 3154550..3154690(-) (degQ) [Bacillus velezensis NJN-6]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=116733 AW02_RS15170 WP_003152043.1 3154550..3154690(-) (degQ) [Bacillus velezensis NJN-6]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |