Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   AB3225_RS08260 Genome accession   NZ_OZ061332
Coordinates   1592986..1593294 (+) Length   102 a.a.
NCBI ID   WP_004270901.1    Uniprot ID   A0AAJ0LFY3
Organism   Latilactobacillus curvatus isolate Latilactobacillus curvatus J116     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1587986..1598294
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3225_RS08220 - 1588268..1588507 (-) 240 WP_004270892.1 cytochrome b5 domain-containing protein -
  AB3225_RS08225 - 1588702..1589037 (+) 336 WP_076786752.1 hypothetical protein -
  AB3225_RS08235 - 1589218..1589595 (-) 378 WP_039099519.1 hypothetical protein -
  AB3225_RS08240 - 1589698..1590198 (+) 501 WP_004270893.1 VanZ family protein -
  AB3225_RS08245 - 1590288..1591019 (+) 732 WP_004270897.1 YebC/PmpR family DNA-binding transcriptional regulator -
  AB3225_RS08250 comGA 1591123..1591998 (+) 876 WP_116843546.1 competence type IV pilus ATPase ComGA Machinery gene
  AB3225_RS08255 comGB 1591988..1592989 (+) 1002 WP_076786758.1 type II secretion system F family protein Machinery gene
  AB3225_RS08260 comGC 1592986..1593294 (+) 309 WP_004270901.1 competence type IV pilus major pilin ComGC Machinery gene
  AB3225_RS08265 - 1593326..1593718 (+) 393 WP_004270899.1 hypothetical protein -
  AB3225_RS08270 - 1593783..1594010 (+) 228 WP_158070299.1 hypothetical protein -
  AB3225_RS08275 - 1593976..1594059 (+) 84 Protein_1573 type II secretion system protein -
  AB3225_RS08280 - 1594063..1594461 (+) 399 WP_240327155.1 ComGF family competence protein -
  AB3225_RS08285 - 1594439..1594741 (+) 303 WP_367370493.1 hypothetical protein -
  AB3225_RS08290 - 1594878..1595897 (+) 1020 WP_307722871.1 class I SAM-dependent methyltransferase -
  AB3225_RS08295 - 1595919..1597112 (+) 1194 WP_004270911.1 acetate/propionate family kinase -
  AB3225_RS08300 - 1597172..1597624 (+) 453 WP_076786762.1 laaL -

Sequence


Protein


Download         Length: 102 a.a.        Molecular weight: 11238.13 Da        Isoelectric Point: 9.6264

>NTDB_id=1165971 AB3225_RS08260 WP_004270901.1 1592986..1593294(+) (comGC) [Latilactobacillus curvatus isolate Latilactobacillus curvatus J116]
MKKKRNAFTLIEMVVVLAVIAMLVLLIAPNLMHQKETAEQKTDTALVATIQTQVELAEDDGKTVSSLADLASGEKYLTNN
QVKQAEKRGITIKDNKVVQNTK

Nucleotide


Download         Length: 309 bp        

>NTDB_id=1165971 AB3225_RS08260 WP_004270901.1 1592986..1593294(+) (comGC) [Latilactobacillus curvatus isolate Latilactobacillus curvatus J116]
ATGAAGAAGAAAAGAAATGCATTTACATTGATCGAAATGGTCGTTGTGCTAGCTGTGATAGCAATGTTAGTCTTGTTAAT
TGCACCTAATTTAATGCATCAGAAAGAGACAGCTGAGCAAAAAACGGATACGGCTCTAGTGGCAACGATTCAAACACAAG
TTGAATTAGCTGAGGATGACGGTAAAACGGTGTCGAGTCTAGCCGATTTAGCATCAGGTGAAAAATATTTAACCAATAAT
CAGGTTAAACAAGCTGAAAAACGCGGCATAACAATTAAGGATAATAAAGTTGTTCAAAATACAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

60

98.039

0.588


Multiple sequence alignment