Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BSU_RS13345 | Genome accession | NZ_OZ024942 |
| Coordinates | 2552446..2552619 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2547446..2557619
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_RS13330 (BSU24570) | gcvT | 2548245..2549333 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BSU_RS13335 (BSU24580) | hepAA | 2549775..2551448 (+) | 1674 | WP_004398544.1 | DEAD/DEAH box helicase | - |
| BSU_RS13340 (BSU24590) | yqhG | 2551469..2552263 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| BSU_RS13345 (BSU24600) | sinI | 2552446..2552619 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| BSU_RS13350 (BSU24610) | sinR | 2552653..2552988 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| BSU_RS13355 (BSU24620) | tasA | 2553081..2553866 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| BSU_RS13360 (BSU24630) | sipW | 2553930..2554502 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| BSU_RS13365 (BSU24640) | tapA | 2554486..2555247 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BSU_RS13370 (BSU24650) | yqzG | 2555519..2555845 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| BSU_RS13375 (BSU24660) | spoIITA | 2555887..2556066 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| BSU_RS13380 (BSU24670) | comGG | 2556137..2556511 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| BSU_RS13385 (BSU24680) | comGF | 2556512..2556895 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| BSU_RS13390 (BSU24690) | comGE | 2556921..2557268 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=1163070 BSU_RS13345 WP_003230187.1 2552446..2552619(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1163070 BSU_RS13345 WP_003230187.1 2552446..2552619(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |