Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   AABJ60_RS11950 Genome accession   NZ_OY754853
Coordinates   2262130..2262759 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli isolate Reference     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2236935..2275262 2262130..2262759 within 0


Gene organization within MGE regions


Location: 2236935..2275262
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABJ60_RS11750 - 2237156..2237428 (-) 273 WP_001342259.1 hypothetical protein -
  AABJ60_RS11755 - 2237564..2237821 (+) 258 WP_001260977.1 type II toxin-antitoxin system ParD family antitoxin -
  AABJ60_RS11760 - 2237827..2238126 (+) 300 WP_000220601.1 type II toxin-antitoxin system RelE/ParE family toxin -
  AABJ60_RS11765 - 2238331..2238675 (-) 345 WP_000206830.1 hypothetical protein -
  AABJ60_RS11770 - 2238672..2239037 (-) 366 WP_001229296.1 HNH endonuclease signature motif containing protein -
  AABJ60_RS11775 - 2239039..2239257 (-) 219 WP_000209152.1 DUF4014 family protein -
  AABJ60_RS11780 - 2239483..2239980 (-) 498 Protein_2313 ead/Ea22-like family protein -
  AABJ60_RS11785 - 2239977..2240153 (-) 177 WP_000753069.1 hypothetical protein -
  AABJ60_RS11790 - 2240146..2240328 (-) 183 WP_001224662.1 hypothetical protein -
  AABJ60_RS11795 - 2240362..2240574 (-) 213 WP_000935422.1 hypothetical protein -
  AABJ60_RS11800 - 2240625..2240981 (-) 357 WP_000403783.1 hypothetical protein -
  AABJ60_RS11805 - 2240959..2241420 (-) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  AABJ60_RS11810 - 2241417..2241713 (-) 297 WP_001266133.1 DUF4406 domain-containing protein -
  AABJ60_RS11815 - 2241710..2242102 (-) 393 WP_001040234.1 DUF977 family protein -
  AABJ60_RS11820 - 2242118..2242843 (-) 726 WP_000450641.1 DUF1627 domain-containing protein -
  AABJ60_RS11825 - 2242877..2243338 (-) 462 WP_000139444.1 replication protein P -
  AABJ60_RS11830 - 2243331..2244341 (-) 1011 WP_000729535.1 DUF1376 domain-containing protein -
  AABJ60_RS11835 - 2244428..2244865 (-) 438 WP_000693932.1 toxin YdaT family protein -
  AABJ60_RS11840 - 2244862..2245122 (-) 261 WP_001172789.1 YdaS family helix-turn-helix protein -
  AABJ60_RS11845 - 2245249..2245641 (+) 393 WP_000578360.1 helix-turn-helix domain-containing protein -
  AABJ60_RS11850 - 2245688..2246047 (-) 360 WP_001022415.1 helix-turn-helix domain-containing protein -
  AABJ60_RS11855 - 2246050..2246352 (-) 303 WP_000692026.1 type II toxin-antitoxin system HigB family toxin -
  AABJ60_RS11860 - 2246688..2246987 (+) 300 WP_012817750.1 hypothetical protein -
  AABJ60_RS11865 ydfC 2247059..2247277 (+) 219 WP_001171921.1 protein YdfC -
  AABJ60_RS11870 dicB 2247846..2248034 (+) 189 WP_000449175.1 cell division inhibition protein DicB -
  AABJ60_RS11875 - 2248031..2248219 (+) 189 WP_000199475.1 DUF1482 family protein -
  AABJ60_RS11880 - 2248314..2250764 (+) 2451 WP_000048499.1 exonuclease -
  AABJ60_RS11885 - 2250832..2251074 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  AABJ60_RS11890 - 2251052..2252071 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  AABJ60_RS11895 yccA 2252479..2253138 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  AABJ60_RS11900 tusE 2253229..2253558 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  AABJ60_RS11905 yccX 2253555..2253833 (-) 279 WP_000048244.1 acylphosphatase -
  AABJ60_RS11910 rlmI 2253928..2255118 (+) 1191 WP_000116301.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  AABJ60_RS11915 hspQ 2255176..2255493 (+) 318 WP_001295356.1 heat shock protein HspQ -
  AABJ60_RS11920 yccU 2255538..2255951 (-) 414 WP_000665217.1 CoA-binding protein -
  AABJ60_RS11925 yccT 2256124..2256786 (+) 663 WP_000847791.1 DUF2057 family protein -
  AABJ60_RS11930 mgsA 2256882..2257340 (+) 459 WP_000424181.1 methylglyoxal synthase -
  AABJ60_RS11935 helD 2257372..2259426 (-) 2055 WP_001297106.1 DNA helicase IV -
  AABJ60_RS11940 yccF 2259549..2259995 (+) 447 WP_001261235.1 YccF domain-containing protein -
  AABJ60_RS11945 yccS 2260005..2262167 (+) 2163 WP_000875023.1 YccS family putative transporter -
  AABJ60_RS11950 sxy/tfoX 2262130..2262759 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  AABJ60_RS11955 sulA 2262978..2263487 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  AABJ60_RS11960 ompA 2263844..2264884 (+) 1041 WP_000750416.1 porin OmpA -
  AABJ60_RS11965 matP 2264959..2265411 (-) 453 WP_000877167.1 macrodomain Ter protein MatP -
  AABJ60_RS11970 ycbZ 2265597..2267357 (+) 1761 WP_000156528.1 Lon protease family protein -
  AABJ60_RS11975 fabA 2267426..2267944 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  AABJ60_RS11980 rmf 2268014..2268181 (-) 168 WP_000828648.1 ribosome modulation factor -
  AABJ60_RS11985 pqiC 2268437..2269000 (-) 564 WP_000759122.1 membrane integrity-associated transporter subunit PqiC -
  AABJ60_RS11990 pqiB 2268997..2270637 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  AABJ60_RS11995 pqiA 2270642..2271895 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  AABJ60_RS12000 uup 2272025..2273932 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=1161345 AABJ60_RS11950 WP_000839153.1 2262130..2262759(-) (sxy/tfoX) [Escherichia coli isolate Reference]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=1161345 AABJ60_RS11950 WP_000839153.1 2262130..2262759(-) (sxy/tfoX) [Escherichia coli isolate Reference]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment