Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QOS64_RS16410 Genome accession   NZ_OX460973
Coordinates   3276433..3276573 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3271433..3281573
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QOS64_RS16385 - 3271760..3272143 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  QOS64_RS16390 comA 3272165..3272809 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  QOS64_RS16395 comP 3272890..3275196 (-) 2307 WP_094032817.1 sensor histidine kinase Regulator
  QOS64_RS16400 comX 3275215..3275391 (-) 177 WP_015240484.1 competence pheromone ComX -
  QOS64_RS16405 - 3275406..3276281 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  QOS64_RS16410 degQ 3276433..3276573 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  QOS64_RS16415 - 3277039..3277380 (+) 342 WP_136396570.1 hypothetical protein -
  QOS64_RS16420 - 3277387..3278610 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  QOS64_RS16425 - 3278740..3280206 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  QOS64_RS16430 - 3280224..3280775 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  QOS64_RS16435 - 3280872..3281270 (-) 399 WP_015240486.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1159471 QOS64_RS16410 WP_003152043.1 3276433..3276573(-) (degQ) [Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1159471 QOS64_RS16410 WP_003152043.1 3276433..3276573(-) (degQ) [Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment