Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | KJP56_RS14280 | Genome accession | NZ_OX419652 |
| Coordinates | 2655039..2655449 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis isolate NRS6131 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2655645..2690375 | 2655039..2655449 | flank | 196 |
Gene organization within MGE regions
Location: 2655039..2690375
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP56_RS14280 (NRS6131_14235) | nucA/comI | 2655039..2655449 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| KJP56_RS14285 (NRS6131_14240) | - | 2655645..2655995 (+) | 351 | Protein_2769 | sigma-70 family RNA polymerase sigma factor | - |
| KJP56_RS14290 (NRS6131_14245) | - | 2656271..2657773 (+) | 1503 | WP_213419127.1 | reverse transcriptase domain-containing protein | - |
| KJP56_RS14295 (NRS6131_14250) | spoIVCA | 2658055..2659515 (-) | 1461 | WP_250622308.1 | site-specific DNA recombinase SpoIVCA | - |
| KJP56_RS14300 | - | 2659473..2659651 (-) | 179 | Protein_2772 | hypothetical protein | - |
| KJP56_RS14305 (NRS6131_14255) | fumC | 2659777..2661165 (-) | 1389 | WP_213419125.1 | class II fumarate hydratase | - |
| KJP56_RS14310 (NRS6131_14260) | - | 2661332..2662222 (+) | 891 | WP_213419124.1 | LysR family transcriptional regulator | - |
| KJP56_RS14315 (NRS6131_14265) | - | 2663164..2663559 (+) | 396 | WP_046160622.1 | VOC family protein | - |
| KJP56_RS14325 (NRS6131_14275) | - | 2664299..2665426 (-) | 1128 | WP_213419123.1 | Rap family tetratricopeptide repeat protein | - |
| KJP56_RS14330 | phrE | 2665834..2665968 (+) | 135 | WP_032725165.1 | phosphatase RapE inhibitor PhrE | - |
| KJP56_RS14335 (NRS6131_14280) | - | 2666103..2666954 (-) | 852 | WP_032725166.1 | aldo/keto reductase | - |
| KJP56_RS14340 (NRS6131_14285) | - | 2667125..2667568 (+) | 444 | WP_029318107.1 | MerR family transcriptional regulator | - |
| KJP56_RS14345 | - | 2667769..2667918 (-) | 150 | WP_234398249.1 | helix-turn-helix domain-containing protein | - |
| KJP56_RS14350 (NRS6131_14300) | - | 2668501..2670323 (+) | 1823 | Protein_2781 | T7SS effector LXG polymorphic toxin | - |
| KJP56_RS14355 (NRS6131_14305) | - | 2670336..2670776 (+) | 441 | WP_101502110.1 | SMI1/KNR4 family protein | - |
| KJP56_RS14360 (NRS6131_14310) | - | 2670876..2671328 (+) | 453 | WP_019260159.1 | SMI1/KNR4 family protein | - |
| KJP56_RS14365 (NRS6131_14315) | - | 2671522..2672067 (-) | 546 | WP_069322772.1 | SMI1/KNR4 family protein | - |
| KJP56_RS14370 (NRS6131_14320) | - | 2672087..2672959 (-) | 873 | WP_250621185.1 | HNH endonuclease signature motif containing protein | - |
| KJP56_RS22685 | - | 2673046..2673147 (+) | 102 | Protein_2786 | hypothetical protein | - |
| KJP56_RS14375 | - | 2673123..2673320 (+) | 198 | Protein_2787 | recombinase family protein | - |
| KJP56_RS14380 | - | 2673286..2673402 (-) | 117 | WP_041850087.1 | hypothetical protein | - |
| KJP56_RS14385 (NRS6131_14325) | - | 2673402..2673794 (-) | 393 | Protein_2789 | sigma-70 family RNA polymerase sigma factor | - |
| KJP56_RS14390 | - | 2673800..2674277 (-) | 478 | Protein_2790 | ImmA/IrrE family metallo-endopeptidase | - |
| KJP56_RS14395 | - | 2674257..2674353 (-) | 97 | Protein_2791 | hypothetical protein | - |
| KJP56_RS14400 (NRS6131_14330) | psiE | 2674903..2675319 (-) | 417 | WP_003246154.1 | phosphate-starvation-inducible protein PsiE | - |
| KJP56_RS14405 (NRS6131_14335) | yrkQ | 2675365..2676663 (-) | 1299 | WP_019712554.1 | two-component system sensor histidine kinase YrkQ | - |
| KJP56_RS14410 (NRS6131_14340) | yrkP | 2676650..2677345 (-) | 696 | WP_021480140.1 | two-component response regulator YrkP | - |
| KJP56_RS14415 (NRS6131_14345) | yrkO | 2677613..2678830 (+) | 1218 | WP_101502113.1 | DUF418 domain-containing protein | - |
| KJP56_RS14420 | - | 2678749..2678997 (+) | 249 | WP_124048084.1 | hypothetical protein | - |
| KJP56_RS14425 (NRS6131_14350) | yrkN | 2679342..2679899 (+) | 558 | WP_029318133.1 | GNAT family N-acetyltransferase | - |
| KJP56_RS14430 (NRS6131_14355) | yrkL | 2680388..2680912 (-) | 525 | WP_003246192.1 | NAD(P)H-dependent oxidoreductase | - |
| KJP56_RS14435 (NRS6131_14360) | yrkK | 2681160..2681636 (-) | 477 | WP_213419128.1 | HXXEE domain-containing protein | - |
| KJP56_RS14440 (NRS6131_14365) | yrkJ | 2682218..2683003 (-) | 786 | WP_151870139.1 | sulfite exporter TauE/SafE family protein | - |
| KJP56_RS14445 (NRS6131_14370) | yrkI | 2683063..2683290 (-) | 228 | WP_003156135.1 | sulfurtransferase TusA family protein | - |
| KJP56_RS14450 (NRS6131_14375) | yrkH | 2683324..2684455 (-) | 1132 | Protein_2802 | MBL fold metallo-hydrolase | - |
| KJP56_RS14455 | - | 2684488..2684764 (-) | 277 | Protein_2803 | DsrE/DsrF/DrsH-like family protein | - |
| KJP56_RS14460 (NRS6131_14385) | yrkF | 2684765..2685322 (-) | 558 | WP_015251636.1 | sulfurtransferase TusA family protein | - |
| KJP56_RS14465 (NRS6131_14390) | yrkE | 2685508..2685990 (-) | 483 | WP_015251635.1 | DsrE/DsrF/DrsH-like family protein | - |
| KJP56_RS14470 (NRS6131_14395) | - | 2686137..2686397 (-) | 261 | WP_003237170.1 | metal-sensitive transcriptional regulator | - |
| KJP56_RS14475 (NRS6131_14400) | - | 2686419..2686736 (-) | 318 | WP_080286220.1 | sulfurtransferase | - |
| KJP56_RS14480 (NRS6131_14405) | yrkC | 2687132..2687692 (-) | 561 | WP_032726228.1 | cupin domain-containing protein | - |
| KJP56_RS14485 | - | 2687918..2688064 (-) | 147 | WP_032726231.1 | hypothetical protein | - |
| KJP56_RS14490 | - | 2688039..2688170 (-) | 132 | Protein_2810 | hypothetical protein | - |
| KJP56_RS14495 (NRS6131_14410) | bltR | 2688235..2689056 (-) | 822 | WP_101502116.1 | multidrug efflux transcriptional regulator BltR | - |
| KJP56_RS14500 (NRS6131_14415) | blt | 2689173..2690375 (+) | 1203 | WP_101502117.1 | multidrug efflux MFS transporter Blt | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=1158082 KJP56_RS14280 WP_009967785.1 2655039..2655449(-) (nucA/comI) [Bacillus subtilis isolate NRS6131]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=1158082 KJP56_RS14280 WP_009967785.1 2655039..2655449(-) (nucA/comI) [Bacillus subtilis isolate NRS6131]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGTGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGTGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |