Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KJP56_RS13690 Genome accession   NZ_OX419652
Coordinates   2556152..2556325 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6131     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2551152..2561325
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP56_RS13675 (NRS6131_13625) gcvT 2551950..2553038 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP56_RS13680 (NRS6131_13630) yqhH 2553480..2555153 (+) 1674 WP_213419112.1 SNF2-related protein -
  KJP56_RS13685 (NRS6131_13635) yqhG 2555174..2555968 (+) 795 WP_032726154.1 YqhG family protein -
  KJP56_RS13690 (NRS6131_13640) sinI 2556152..2556325 (+) 174 WP_014477323.1 anti-repressor SinI family protein Regulator
  KJP56_RS13695 (NRS6131_13645) sinR 2556359..2556694 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP56_RS13700 (NRS6131_13650) tasA 2556786..2557571 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  KJP56_RS13705 (NRS6131_13655) sipW 2557636..2558208 (-) 573 WP_134991456.1 signal peptidase I -
  KJP56_RS13710 (NRS6131_13660) tapA 2558192..2558953 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  KJP56_RS13715 (NRS6131_13665) yqzG 2559225..2559551 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP56_RS13720 (NRS6131_13670) spoIIT 2559593..2559772 (-) 180 WP_014480252.1 YqzE family protein -
  KJP56_RS13725 (NRS6131_13675) comGG 2559844..2560218 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  KJP56_RS13730 (NRS6131_13680) comGF 2560219..2560602 (-) 384 WP_101502451.1 ComG operon protein ComGF Machinery gene
  KJP56_RS13735 (NRS6131_13685) comGE 2560628..2560975 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=1158069 KJP56_RS13690 WP_014477323.1 2556152..2556325(+) (sinI) [Bacillus subtilis isolate NRS6131]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1158069 KJP56_RS13690 WP_014477323.1 2556152..2556325(+) (sinI) [Bacillus subtilis isolate NRS6131]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982

Multiple sequence alignment