Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP60_RS13715 Genome accession   NZ_OX419580
Coordinates   2600971..2601144 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate NRS6116     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2595971..2606144
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP60_RS13700 (NRS6116_13725) gcvT 2596770..2597858 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP60_RS13705 (NRS6116_13730) yqhH 2598300..2599973 (+) 1674 WP_004398544.1 SNF2-related protein -
  KJP60_RS13710 (NRS6116_13735) yqhG 2599994..2600788 (+) 795 WP_003230200.1 YqhG family protein -
  KJP60_RS13715 (NRS6116_13740) sinI 2600971..2601144 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP60_RS13720 (NRS6116_13745) sinR 2601178..2601513 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP60_RS13725 (NRS6116_13750) tasA 2601606..2602391 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  KJP60_RS13730 (NRS6116_13755) sipW 2602455..2603027 (-) 573 WP_003246088.1 signal peptidase I -
  KJP60_RS13735 (NRS6116_13760) tapA 2603011..2603772 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  KJP60_RS13740 (NRS6116_13765) yqzG 2604044..2604370 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP60_RS13745 (NRS6116_13770) spoIIT 2604412..2604591 (-) 180 WP_003230176.1 YqzE family protein -
  KJP60_RS13750 (NRS6116_13775) comGG 2604662..2605036 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  KJP60_RS13755 (NRS6116_13780) comGF 2605037..2605420 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  KJP60_RS13760 (NRS6116_13785) comGE 2605446..2605793 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1157988 KJP60_RS13715 WP_003230187.1 2600971..2601144(+) (sinI) [Bacillus subtilis isolate NRS6116]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1157988 KJP60_RS13715 WP_003230187.1 2600971..2601144(+) (sinI) [Bacillus subtilis isolate NRS6116]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment