Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KJP43_RS17455 Genome accession   NZ_OX419579
Coordinates   3303051..3303191 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6103     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3298051..3308191
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP43_RS17430 (NRS6103_17265) yuxO 3298401..3298781 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  KJP43_RS17435 (NRS6103_17270) comA 3298800..3299444 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP43_RS17440 (NRS6103_17275) comP 3299525..3301822 (-) 2298 WP_153912412.1 histidine kinase Regulator
  KJP43_RS17445 (NRS6103_17280) comX 3301830..3301991 (-) 162 WP_049140565.1 competence pheromone ComX -
  KJP43_RS17450 (NRS6103_17285) - 3302006..3302866 (-) 861 WP_040081966.1 polyprenyl synthetase family protein -
  KJP43_RS17455 (NRS6103_17290) degQ 3303051..3303191 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP43_RS17460 - 3303413..3303475 (+) 63 Protein_3376 hypothetical protein -
  KJP43_RS17465 (NRS6103_17295) - 3303653..3304021 (+) 369 WP_017695529.1 hypothetical protein -
  KJP43_RS17470 (NRS6103_17300) pdeH 3303997..3305226 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP43_RS17475 (NRS6103_17305) pncB 3305363..3306835 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP43_RS17480 (NRS6103_17310) pncA 3306851..3307402 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  KJP43_RS17485 (NRS6103_17315) yueI 3307499..3307897 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1157928 KJP43_RS17455 WP_003220708.1 3303051..3303191(-) (degQ) [Bacillus subtilis isolate NRS6103]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1157928 KJP43_RS17455 WP_003220708.1 3303051..3303191(-) (degQ) [Bacillus subtilis isolate NRS6103]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment