Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP51_RS12230 Genome accession   NZ_OX419576
Coordinates   2399506..2399679 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate NRS6105     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2394506..2404679
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP51_RS12215 (NRS6105_12120) gcvT 2395305..2396393 (-) 1089 WP_213379484.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP51_RS12220 (NRS6105_12125) yqhH 2396835..2398508 (+) 1674 WP_213379486.1 SNF2-related protein -
  KJP51_RS12225 (NRS6105_12130) yqhG 2398529..2399323 (+) 795 WP_003230200.1 YqhG family protein -
  KJP51_RS12230 (NRS6105_12135) sinI 2399506..2399679 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP51_RS12235 (NRS6105_12140) sinR 2399713..2400048 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP51_RS12240 (NRS6105_12145) tasA 2400141..2400926 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  KJP51_RS12245 (NRS6105_12150) sipW 2400990..2401562 (-) 573 WP_003246088.1 signal peptidase I -
  KJP51_RS12250 (NRS6105_12155) tapA 2401546..2402307 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  KJP51_RS12255 (NRS6105_12160) yqzG 2402579..2402905 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP51_RS12260 (NRS6105_12165) spoIIT 2402947..2403126 (-) 180 WP_003230176.1 YqzE family protein -
  KJP51_RS12265 (NRS6105_12170) comGG 2403197..2403571 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  KJP51_RS12270 comGF 2403572..2403955 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  KJP51_RS12275 (NRS6105_12180) comGE 2403981..2404328 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1157672 KJP51_RS12230 WP_003230187.1 2399506..2399679(+) (sinI) [Bacillus subtilis isolate NRS6105]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1157672 KJP51_RS12230 WP_003230187.1 2399506..2399679(+) (sinI) [Bacillus subtilis isolate NRS6105]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment