Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP52_RS12495 Genome accession   NZ_OX419575
Coordinates   2439928..2440101 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate NRS6121     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2434928..2445101
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP52_RS12480 (NRS6121_12385) gcvT 2435727..2436815 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP52_RS12485 (NRS6121_12390) yqhH 2437257..2438930 (+) 1674 WP_003230203.1 SNF2-related protein -
  KJP52_RS12490 (NRS6121_12395) yqhG 2438951..2439745 (+) 795 WP_003230200.1 YqhG family protein -
  KJP52_RS12495 (NRS6121_12400) sinI 2439928..2440101 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP52_RS12500 (NRS6121_12405) sinR 2440135..2440470 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP52_RS12505 (NRS6121_12410) tasA 2440563..2441348 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  KJP52_RS12510 (NRS6121_12415) sipW 2441412..2441984 (-) 573 WP_003230181.1 signal peptidase I -
  KJP52_RS12515 (NRS6121_12420) tapA 2441968..2442729 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  KJP52_RS12520 (NRS6121_12425) yqzG 2443001..2443327 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP52_RS12525 (NRS6121_12430) spoIIT 2443369..2443548 (-) 180 WP_003230176.1 YqzE family protein -
  KJP52_RS12530 (NRS6121_12435) comGG 2443619..2443993 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  KJP52_RS12535 (NRS6121_12440) comGF 2443994..2444377 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  KJP52_RS12540 (NRS6121_12445) comGE 2444403..2444750 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1157586 KJP52_RS12495 WP_003230187.1 2439928..2440101(+) (sinI) [Bacillus subtilis isolate NRS6121]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1157586 KJP52_RS12495 WP_003230187.1 2439928..2440101(+) (sinI) [Bacillus subtilis isolate NRS6121]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment