Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KJP42_RS16340 Genome accession   NZ_OX419567
Coordinates   3142731..3142871 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6107     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3137731..3147871
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP42_RS16315 (NRS6107_16185) yuxO 3138044..3138424 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  KJP42_RS16320 (NRS6107_16190) comA 3138443..3139087 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP42_RS16325 (NRS6107_16195) comP 3139168..3141477 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  KJP42_RS16330 (NRS6107_16200) comX 3141492..3141659 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  KJP42_RS16335 (NRS6107_16205) comQ 3141647..3142546 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  KJP42_RS16340 (NRS6107_16210) degQ 3142731..3142871 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP42_RS16345 - 3143093..3143218 (+) 126 WP_003228793.1 hypothetical protein -
  KJP42_RS16350 (NRS6107_16215) - 3143332..3143700 (+) 369 WP_003243784.1 hypothetical protein -
  KJP42_RS16355 (NRS6107_16220) pdeH 3143676..3144905 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP42_RS16360 (NRS6107_16225) pncB 3145042..3146514 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP42_RS16365 (NRS6107_16230) pncA 3146530..3147081 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  KJP42_RS16370 (NRS6107_16235) yueI 3147178..3147576 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1157274 KJP42_RS16340 WP_003220708.1 3142731..3142871(-) (degQ) [Bacillus subtilis isolate NRS6107]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1157274 KJP42_RS16340 WP_003220708.1 3142731..3142871(-) (degQ) [Bacillus subtilis isolate NRS6107]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment