Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KJP64_RS16145 Genome accession   NZ_OX419565
Coordinates   3104231..3104371 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6145     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3099231..3109371
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP64_RS16120 (NRS6145_15940) yuxO 3099581..3099961 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  KJP64_RS16125 (NRS6145_15945) comA 3099980..3100624 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP64_RS16130 (NRS6145_15950) comP 3100705..3103002 (-) 2298 WP_033884760.1 histidine kinase Regulator
  KJP64_RS16135 (NRS6145_15955) comX 3103010..3103171 (-) 162 WP_003228803.1 competence pheromone ComX -
  KJP64_RS16140 (NRS6145_15960) - 3103186..3104046 (-) 861 WP_192857944.1 polyprenyl synthetase family protein -
  KJP64_RS16145 (NRS6145_15965) degQ 3104231..3104371 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP64_RS16150 - 3104593..3104718 (+) 126 WP_003228793.1 hypothetical protein -
  KJP64_RS16155 (NRS6145_15970) - 3104832..3105200 (+) 369 WP_014477834.1 hypothetical protein -
  KJP64_RS16160 (NRS6145_15975) pdeH 3105176..3106405 (-) 1230 WP_003228790.1 cyclic di-GMP phosphodiesterase -
  KJP64_RS16165 (NRS6145_15980) pncB 3106542..3108014 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP64_RS16170 (NRS6145_15985) pncA 3108030..3108581 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  KJP64_RS16175 (NRS6145_15990) yueI 3108678..3109076 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1157188 KJP64_RS16145 WP_003220708.1 3104231..3104371(-) (degQ) [Bacillus subtilis isolate NRS6145]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1157188 KJP64_RS16145 WP_003220708.1 3104231..3104371(-) (degQ) [Bacillus subtilis isolate NRS6145]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment