Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KJP48_RS17290 Genome accession   NZ_OX419564
Coordinates   3265157..3265297 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6127     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3260157..3270297
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP48_RS17265 (NRS6127_17130) yuxO 3260507..3260887 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  KJP48_RS17270 (NRS6127_17135) comA 3260906..3261550 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP48_RS17275 (NRS6127_17140) comP 3261631..3263928 (-) 2298 WP_153912412.1 histidine kinase Regulator
  KJP48_RS17280 (NRS6127_17145) comX 3263936..3264097 (-) 162 WP_049140565.1 competence pheromone ComX -
  KJP48_RS17285 (NRS6127_17150) - 3264112..3264972 (-) 861 WP_040081966.1 polyprenyl synthetase family protein -
  KJP48_RS17290 (NRS6127_17155) degQ 3265157..3265297 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP48_RS17295 - 3265519..3265581 (+) 63 Protein_3343 hypothetical protein -
  KJP48_RS17300 (NRS6127_17160) - 3265759..3266127 (+) 369 WP_017695529.1 hypothetical protein -
  KJP48_RS17305 (NRS6127_17165) pdeH 3266103..3267332 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP48_RS17310 (NRS6127_17170) pncB 3267469..3268941 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP48_RS17315 (NRS6127_17175) pncA 3268957..3269508 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  KJP48_RS17320 (NRS6127_17180) yueI 3269605..3270003 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1157104 KJP48_RS17290 WP_003220708.1 3265157..3265297(-) (degQ) [Bacillus subtilis isolate NRS6127]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1157104 KJP48_RS17290 WP_003220708.1 3265157..3265297(-) (degQ) [Bacillus subtilis isolate NRS6127]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment