Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   KJP66_RS17100 Genome accession   NZ_OX419563
Coordinates   3255557..3255724 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis isolate NRS6153     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250557..3260724
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP66_RS17070 (NRS6153_16955) mrpE 3250952..3251428 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  KJP66_RS17075 (NRS6153_16960) mrpF 3251428..3251712 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  KJP66_RS17080 (NRS6153_16965) mnhG 3251696..3252070 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  KJP66_RS17085 (NRS6153_16970) yuxO 3252109..3252489 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  KJP66_RS17090 (NRS6153_16975) comA 3252508..3253152 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP66_RS17095 (NRS6153_16980) comP 3253233..3255542 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  KJP66_RS17100 (NRS6153_16985) comX 3255557..3255724 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  KJP66_RS17105 (NRS6153_16990) comQ 3255712..3256611 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  KJP66_RS17110 (NRS6153_16995) degQ 3256796..3256936 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP66_RS17115 - 3257158..3257283 (+) 126 WP_003228793.1 hypothetical protein -
  KJP66_RS17120 (NRS6153_17000) - 3257397..3257765 (+) 369 WP_003243784.1 hypothetical protein -
  KJP66_RS17125 (NRS6153_17005) pdeH 3257741..3258970 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP66_RS17130 (NRS6153_17010) pncB 3259107..3260579 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=1157023 KJP66_RS17100 WP_003242801.1 3255557..3255724(-) (comX) [Bacillus subtilis isolate NRS6153]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1157023 KJP66_RS17100 WP_003242801.1 3255557..3255724(-) (comX) [Bacillus subtilis isolate NRS6153]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment