Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP66_RS13005 Genome accession   NZ_OX419563
Coordinates   2513360..2513533 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate NRS6153     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2508360..2518533
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP66_RS12990 (NRS6153_12905) gcvT 2509159..2510247 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP66_RS12995 (NRS6153_12910) yqhH 2510689..2512362 (+) 1674 WP_003230203.1 SNF2-related protein -
  KJP66_RS13000 (NRS6153_12915) yqhG 2512383..2513177 (+) 795 WP_003230200.1 YqhG family protein -
  KJP66_RS13005 (NRS6153_12920) sinI 2513360..2513533 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP66_RS13010 (NRS6153_12925) sinR 2513567..2513902 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP66_RS13015 (NRS6153_12930) tasA 2513995..2514780 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  KJP66_RS13020 (NRS6153_12935) sipW 2514844..2515416 (-) 573 WP_003230181.1 signal peptidase I -
  KJP66_RS13025 (NRS6153_12940) tapA 2515400..2516161 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  KJP66_RS13030 (NRS6153_12945) yqzG 2516433..2516759 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP66_RS13035 (NRS6153_12950) spoIIT 2516801..2516980 (-) 180 WP_003230176.1 YqzE family protein -
  KJP66_RS13040 (NRS6153_12955) comGG 2517051..2517425 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  KJP66_RS13045 (NRS6153_12960) comGF 2517426..2517809 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  KJP66_RS13050 (NRS6153_12965) comGE 2517835..2518182 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1156999 KJP66_RS13005 WP_003230187.1 2513360..2513533(+) (sinI) [Bacillus subtilis isolate NRS6153]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1156999 KJP66_RS13005 WP_003230187.1 2513360..2513533(+) (sinI) [Bacillus subtilis isolate NRS6153]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment