Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KJP72_RS17365 Genome accession   NZ_OX419557
Coordinates   3270833..3270973 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6186     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3265833..3275973
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP72_RS17340 (NRS6186_17220) yuxO 3266110..3266490 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  KJP72_RS17345 (NRS6186_17225) comA 3266509..3267153 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP72_RS17350 (NRS6186_17230) comP 3267234..3269546 (-) 2313 WP_069703660.1 histidine kinase Regulator
  KJP72_RS17355 (NRS6186_17235) comX 3269562..3269783 (-) 222 WP_014480704.1 competence pheromone ComX -
  KJP72_RS17360 (NRS6186_17240) - 3269785..3270648 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  KJP72_RS17365 (NRS6186_17245) degQ 3270833..3270973 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP72_RS17370 - 3271195..3271257 (+) 63 Protein_3358 hypothetical protein -
  KJP72_RS17375 (NRS6186_17250) - 3271435..3271803 (+) 369 WP_017695529.1 hypothetical protein -
  KJP72_RS17380 (NRS6186_17255) pdeH 3271779..3273008 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP72_RS17385 (NRS6186_17260) pncB 3273145..3274617 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP72_RS17390 (NRS6186_17265) pncA 3274633..3275184 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  KJP72_RS17395 (NRS6186_17270) yueI 3275281..3275679 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1156781 KJP72_RS17365 WP_003220708.1 3270833..3270973(-) (degQ) [Bacillus subtilis isolate NRS6186]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1156781 KJP72_RS17365 WP_003220708.1 3270833..3270973(-) (degQ) [Bacillus subtilis isolate NRS6186]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment