Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   KJP72_RS13435 Genome accession   NZ_OX419557
Coordinates   2554208..2554591 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6186     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2549208..2559591
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP72_RS13395 (NRS6186_13350) sinI 2550141..2550314 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP72_RS13400 (NRS6186_13355) sinR 2550348..2550683 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP72_RS13405 (NRS6186_13360) tasA 2550776..2551561 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  KJP72_RS13410 (NRS6186_13365) sipW 2551625..2552197 (-) 573 WP_072692741.1 signal peptidase I -
  KJP72_RS13415 (NRS6186_13370) tapA 2552181..2552942 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KJP72_RS13420 (NRS6186_13375) yqzG 2553214..2553540 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP72_RS13425 (NRS6186_13380) spoIIT 2553582..2553761 (-) 180 WP_029726723.1 YqzE family protein -
  KJP72_RS13430 (NRS6186_13385) comGG 2553833..2554207 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  KJP72_RS13435 (NRS6186_13390) comGF 2554208..2554591 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  KJP72_RS13440 (NRS6186_13395) comGE 2554617..2554964 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  KJP72_RS13445 (NRS6186_13400) comGD 2554948..2555379 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  KJP72_RS13450 (NRS6186_13405) comGC 2555369..2555665 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  KJP72_RS13455 (NRS6186_13410) comGB 2555679..2556716 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  KJP72_RS13460 (NRS6186_13415) comGA 2556703..2557773 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP72_RS13465 (NRS6186_13425) - 2557986..2558183 (-) 198 WP_029726717.1 hypothetical protein -
  KJP72_RS13470 (NRS6186_13430) corA 2558185..2559138 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=1156760 KJP72_RS13435 WP_029726721.1 2554208..2554591(-) (comGF) [Bacillus subtilis isolate NRS6186]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1156760 KJP72_RS13435 WP_029726721.1 2554208..2554591(-) (comGF) [Bacillus subtilis isolate NRS6186]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment