Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KJP65_RS16935 Genome accession   NZ_OX419555
Coordinates   3184409..3184549 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6181     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3179409..3189549
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP65_RS16910 (NRS6181_16800) yuxO 3179686..3180066 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  KJP65_RS16915 (NRS6181_16805) comA 3180085..3180729 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP65_RS16920 (NRS6181_16810) comP 3180810..3183122 (-) 2313 WP_069703660.1 histidine kinase Regulator
  KJP65_RS16925 (NRS6181_16815) comX 3183138..3183359 (-) 222 WP_014480704.1 competence pheromone ComX -
  KJP65_RS16930 (NRS6181_16820) - 3183361..3184224 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  KJP65_RS16935 (NRS6181_16825) degQ 3184409..3184549 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP65_RS16940 - 3184771..3184833 (+) 63 Protein_3272 hypothetical protein -
  KJP65_RS16945 (NRS6181_16830) - 3185011..3185379 (+) 369 WP_017695529.1 hypothetical protein -
  KJP65_RS16950 (NRS6181_16835) pdeH 3185355..3186584 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP65_RS16955 (NRS6181_16840) pncB 3186721..3188193 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP65_RS16960 (NRS6181_16845) pncA 3188209..3188760 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  KJP65_RS16965 (NRS6181_16850) yueI 3188857..3189255 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1156702 KJP65_RS16935 WP_003220708.1 3184409..3184549(-) (degQ) [Bacillus subtilis isolate NRS6181]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1156702 KJP65_RS16935 WP_003220708.1 3184409..3184549(-) (degQ) [Bacillus subtilis isolate NRS6181]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment