Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | KJP53_RS13075 | Genome accession | NZ_OX419551 |
| Coordinates | 2541377..2541787 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis isolate NRS6190 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2534480..2588233 | 2541377..2541787 | within | 0 |
Gene organization within MGE regions
Location: 2534480..2588233
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP53_RS13035 (NRS6190_12985) | yqeH | 2534480..2535580 (-) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| KJP53_RS13040 (NRS6190_12990) | yqeG | 2535584..2536102 (-) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| KJP53_RS13045 | - | 2536464..2536604 (+) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| KJP53_RS13050 (NRS6190_13000) | yqeF | 2536910..2537641 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| KJP53_RS13055 (NRS6190_13005) | cwlH | 2537893..2538645 (-) | 753 | WP_003229963.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| KJP53_RS13060 (NRS6190_13010) | yqeD | 2538832..2539458 (+) | 627 | WP_003229962.1 | TVP38/TMEM64 family protein | - |
| KJP53_RS13065 (NRS6190_13015) | gnd | 2539477..2540370 (-) | 894 | WP_003229961.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| KJP53_RS13070 (NRS6190_13020) | yqeB | 2540622..2541344 (+) | 723 | WP_010886572.1 | hypothetical protein | - |
| KJP53_RS13075 (NRS6190_13025) | nucA/comI | 2541377..2541787 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| KJP53_RS13080 (NRS6190_13030) | - | 2541983..2542330 (+) | 348 | Protein_2528 | sigma-70 family RNA polymerase sigma factor | - |
| KJP53_RS13085 (NRS6190_13035) | spoIVCA | 2542361..2543821 (-) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| KJP53_RS13090 | - | 2543779..2543957 (-) | 179 | Protein_2530 | hypothetical protein | - |
| KJP53_RS13095 (NRS6190_13040) | arsC | 2544312..2544731 (-) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| KJP53_RS13100 (NRS6190_13045) | acr3 | 2544743..2545783 (-) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| KJP53_RS13105 (NRS6190_13050) | yqcK | 2545806..2546246 (-) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| KJP53_RS13110 (NRS6190_13055) | arsR | 2546307..2546624 (-) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| KJP53_RS13115 (NRS6190_13060) | yqcI | 2546996..2547760 (-) | 765 | WP_004398670.1 | YqcI/YcgG family protein | - |
| KJP53_RS13120 (NRS6190_13065) | rapE | 2548203..2549330 (+) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| KJP53_RS13125 (NRS6190_13070) | phrE | 2549320..2549454 (+) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| KJP53_RS13130 (NRS6190_13075) | - | 2549564..2549722 (+) | 159 | WP_003245945.1 | hypothetical protein | - |
| KJP53_RS13135 (NRS6190_13080) | yqcG | 2550092..2551687 (+) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| KJP53_RS13140 (NRS6190_13085) | yqcF | 2551702..2552280 (+) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| KJP53_RS13145 (NRS6190_13090) | - | 2552398..2552544 (+) | 147 | WP_009967791.1 | hypothetical protein | - |
| KJP53_RS13150 (NRS6190_13095) | - | 2552541..2552903 (-) | 363 | WP_003229947.1 | hypothetical protein | - |
| KJP53_RS13155 (NRS6190_13100) | - | 2552919..2553398 (-) | 480 | WP_004399085.1 | hypothetical protein | - |
| KJP53_RS13160 (NRS6190_13105) | cwlA | 2553563..2554381 (-) | 819 | WP_003229946.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| KJP53_RS13165 (NRS6190_13110) | yqxH | 2554426..2554848 (-) | 423 | WP_003246208.1 | holin family protein | - |
| KJP53_RS13170 (NRS6190_13115) | yqxG | 2554893..2555786 (-) | 894 | WP_003246010.1 | hypothetical protein | - |
| KJP53_RS13175 (NRS6190_13120) | yqcE | 2555874..2556038 (-) | 165 | WP_003229944.1 | XkdX family protein | - |
| KJP53_RS13180 (NRS6190_13125) | yqcD | 2556035..2556370 (-) | 336 | WP_009967793.1 | XkdW family protein | - |
| KJP53_RS13185 (NRS6190_13130) | yqcC | 2556380..2557480 (-) | 1101 | WP_003229943.1 | pyocin knob domain-containing protein | - |
| KJP53_RS13190 (NRS6190_13135) | - | 2557483..2557755 (-) | 273 | WP_003229942.1 | hypothetical protein | - |
| KJP53_RS13195 (NRS6190_13140) | yqcA | 2557752..2558330 (-) | 579 | WP_003229941.1 | YmfQ family protein | - |
| KJP53_RS13200 (NRS6190_13145) | yqbT | 2558314..2559360 (-) | 1047 | WP_003229940.1 | baseplate J/gp47 family protein | - |
| KJP53_RS13205 (NRS6190_13150) | yqbS | 2559353..2559778 (-) | 426 | WP_004398572.1 | DUF2634 domain-containing protein | - |
| KJP53_RS13210 (NRS6190_13155) | yqbR | 2559791..2560054 (-) | 264 | WP_003229938.1 | DUF2577 family protein | - |
| KJP53_RS13215 (NRS6190_13160) | yqbQ | 2560051..2561031 (-) | 981 | WP_004398524.1 | hypothetical protein | - |
| KJP53_RS13220 (NRS6190_13165) | yqbP | 2561044..2561703 (-) | 660 | WP_004398548.1 | LysM peptidoglycan-binding domain-containing protein | - |
| KJP53_RS13225 (NRS6190_13170) | yqbO | 2561696..2566453 (-) | 4758 | WP_003246092.1 | phage tail tape measure protein | - |
| KJP53_RS13230 | - | 2566456..2566593 (-) | 138 | WP_003229934.1 | hypothetical protein | - |
| KJP53_RS13235 (NRS6190_13175) | - | 2566635..2567084 (-) | 450 | WP_003229933.1 | phage portal protein | - |
| KJP53_RS13240 (NRS6190_13180) | txpA | 2567230..2567409 (+) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| KJP53_RS13245 (NRS6190_13190) | bsrH | 2567789..2567878 (+) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| KJP53_RS13250 (NRS6190_13195) | yqbM | 2568132..2568575 (-) | 444 | WP_003229930.1 | phage tail tube protein | - |
| KJP53_RS13255 (NRS6190_13200) | yqbK | 2568578..2569978 (-) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| KJP53_RS13260 (NRS6190_13205) | - | 2569979..2570170 (-) | 192 | WP_010886574.1 | hypothetical protein | - |
| KJP53_RS13265 (NRS6190_13210) | yqbJ | 2570167..2570604 (-) | 438 | WP_003229927.1 | DUF6838 family protein | - |
| KJP53_RS13270 (NRS6190_13215) | yqbI | 2570617..2571120 (-) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| KJP53_RS13275 (NRS6190_13220) | yqbH | 2571117..2571479 (-) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| KJP53_RS13280 (NRS6190_13225) | yqbG | 2571476..2571871 (-) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| KJP53_RS13285 (NRS6190_13230) | yqbF | 2571875..2572186 (-) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| KJP53_RS13290 (NRS6190_13235) | yqbE | 2572197..2573132 (-) | 936 | WP_003229922.1 | phage major capsid protein | - |
| KJP53_RS13295 (NRS6190_13240) | yqbD | 2573151..2574119 (-) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| KJP53_RS13300 (NRS6190_13245) | - | 2574152..2574805 (-) | 654 | WP_003229920.1 | hypothetical protein | - |
| KJP53_RS13305 (NRS6190_13250) | yqbB | 2574846..2575763 (-) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| KJP53_RS13310 (NRS6190_13255) | yqbA | 2575760..2577292 (-) | 1533 | WP_004398894.1 | phage portal protein | - |
| KJP53_RS13315 (NRS6190_13260) | yqaT | 2577296..2578591 (-) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| KJP53_RS13320 (NRS6190_13265) | terS | 2578584..2579303 (-) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| KJP53_RS13325 (NRS6190_13270) | - | 2579371..2579835 (-) | 465 | WP_004398685.1 | hypothetical protein | - |
| KJP53_RS13330 (NRS6190_13275) | yqaQ | 2579979..2580434 (-) | 456 | WP_004398775.1 | hypothetical protein | - |
| KJP53_RS13335 (NRS6190_13280) | - | 2580632..2581561 (+) | 930 | WP_003229913.1 | hypothetical protein | - |
| KJP53_RS13340 (NRS6190_13285) | yqaO | 2581635..2581841 (-) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| KJP53_RS13345 (NRS6190_13290) | yqaN | 2581923..2582351 (-) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KJP53_RS13350 (NRS6190_13295) | - | 2582447..2582596 (-) | 150 | WP_003229910.1 | hypothetical protein | - |
| KJP53_RS13355 (NRS6190_13300) | sknM | 2582587..2583528 (-) | 942 | WP_075058863.1 | ATP-binding protein | - |
| KJP53_RS13360 (NRS6190_13305) | yqaL | 2583410..2584087 (-) | 678 | WP_116362964.1 | DnaD domain protein | - |
| KJP53_RS13365 (NRS6190_13310) | yqaK | 2584163..2585017 (-) | 855 | WP_003229907.1 | recombinase RecT | - |
| KJP53_RS13370 (NRS6190_13315) | yqaJ | 2585020..2585979 (-) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| KJP53_RS13375 (NRS6190_13320) | - | 2586085..2586279 (-) | 195 | WP_003229905.1 | hypothetical protein | - |
| KJP53_RS13380 (NRS6190_13325) | - | 2586239..2586412 (-) | 174 | WP_119123069.1 | hypothetical protein | - |
| KJP53_RS13385 (NRS6190_13330) | sknH | 2586409..2586666 (-) | 258 | WP_003245994.1 | YqaH family protein | - |
| KJP53_RS13390 (NRS6190_13335) | yqaG | 2586663..2587232 (-) | 570 | WP_004398626.1 | helix-turn-helix transcriptional regulator | - |
| KJP53_RS13395 (NRS6190_13340) | - | 2587306..2587446 (-) | 141 | WP_003229902.1 | hypothetical protein | - |
| KJP53_RS13400 (NRS6190_13345) | yqaF | 2587476..2587706 (-) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| KJP53_RS13405 (NRS6190_13350) | sknR | 2587883..2588233 (+) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=1156450 KJP53_RS13075 WP_009967785.1 2541377..2541787(-) (nucA/comI) [Bacillus subtilis isolate NRS6190]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=1156450 KJP53_RS13075 WP_009967785.1 2541377..2541787(-) (nucA/comI) [Bacillus subtilis isolate NRS6190]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |