Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   V529_RS15335 Genome accession   NZ_CP006890
Coordinates   3204823..3204963 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis SQR9     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3199823..3209963
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V529_RS15310 (V529_31330) - 3200163..3200546 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  V529_RS15315 (V529_31340) comA 3200568..3201212 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  V529_RS15320 (V529_31350) comP 3201293..3203584 (-) 2292 WP_038459663.1 histidine kinase Regulator
  V529_RS15325 (V529_31360) comX 3203596..3203760 (-) 165 WP_007613432.1 competence pheromone ComX -
  V529_RS15330 (V529_31370) - 3203760..3204638 (-) 879 WP_038460875.1 polyprenyl synthetase family protein -
  V529_RS15335 (V529_31380) degQ 3204823..3204963 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  V529_RS15340 (V529_31400) - 3205429..3205770 (+) 342 WP_038459666.1 hypothetical protein -
  V529_RS15345 (V529_31410) - 3205777..3207000 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  V529_RS15350 (V529_31420) - 3207130..3208596 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  V529_RS15355 (V529_31430) - 3208614..3209165 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  V529_RS15360 (V529_31440) - 3209262..3209660 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=114864 V529_RS15335 WP_003152043.1 3204823..3204963(-) (degQ) [Bacillus velezensis SQR9]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=114864 V529_RS15335 WP_003152043.1 3204823..3204963(-) (degQ) [Bacillus velezensis SQR9]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment